SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G28380.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G28380.1
Domain Number 1 Region: 898-1185
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-75
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 192-551
Classification Level Classification E-value
Superfamily RNI-like 5.18e-65
Family Cyclin A/CDK2-associated p19, Skp2 0.085
Further Details:      
 
Domain Number 3 Region: 491-806
Classification Level Classification E-value
Superfamily RNI-like 5.18e-59
Family 28-residue LRR 0.078
Further Details:      
 
Domain Number 4 Region: 43-225
Classification Level Classification E-value
Superfamily L domain-like 1.87e-26
Family Polygalacturonase inhibiting protein PGIP 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G28380.1   Gene: BRADI3G28380   Transcript: BRADI3G28380.1
Sequence length 1212
Comment pep:novel chromosome:Brachy1.0:3:29713444:29717902:1 gene:BRADI3G28380 transcript:BRADI3G28380.1
Sequence
MPTPAAVFAGLLLLVLTSGAANAATGPEAKALLAWKASLGNPPALSTWAESSGSVCAGWR
GVSCDATGRVTSLRLRGLGLAGRLGPLGTAALRDLATLDLNGNNLAGGIPSNISLLQSLS
TLDLGSNGFDGPIPPQLGDLSGLVDLRLYNNNLSGDVPHQLSRLPRIAHFDLGSNYLTSL
DGFSPMPTVSFLSLYLNNLNGSFPEFVLGSANVTYLDLSQNALSGTIPDSLPENLAYLNL
STNGFSGRIPASLSKLRKLQDLRIVSNNLTGGIPDFLGSMSQLRALELGANPLLGGPIPP
VLGQLRLLQHLDLKSAGLDSTIPPQLGNLVNLNYVDLSGNKLTGVLPPALASMRRMREFG
ISGNKFAGQIPSALFTNWPELISFQAQENSFTGKIPPELGKATKLNILYLYSNNLTGSIP
AELGELVSLLQLDLSVNSLTGSIPSSFGKLTQLTRLALFFNQLTGALPPEIGNMTALEIL
DVNTNHLEGELPAAITSLRNLKYLALFDNNFSGTIPPDLGKGLSLIDASFANNSFSGELP
RRLCDGLALQNFTANRNKFSGTLPPCLKNCTELYRVRLEGNHFTGDITEAFGVHPSLVYL
DVSENKLTGRLSSDWGQCVNITLLHMDGNALSGGIPAVFGGMEKLQDLSLAENNLSGGIP
SELGRLGLLFNLNLSHNYISGPIPENLGNISKLQKVDLSGNSLTGTIPVGIGKLSALIFL
DLSKNKLSGQIPSELGNLIQLQILLDVSSNSLSGPIPSNLDKLRTLQKLNLSRNELSGSI
PAGFSSMSSLEAVDFSYNRLTGKIPSGNNIFQNTSADAYIGNLGLCGNVQGVAPCDLNSG
SASSGHRRRIVIATVVVVVGVVLLAAVAACLILMCRRRPCEHKVLEANTNDAFESMIWEK
EGKFTFFDIMNATDNFNETFCIGKGGFGTVYRAELASGQVVAVKRFHVAETGDISDVSKK
SFENEIKALTEVRHRNIVKLHGFCTSGDYMYLVYECLERGSLAKTLYGEEGKKNLDWDVR
MKVIQGVAHALAYLHHDCNPPIVHRDITLNNILLESDFEPRLCDFGTAKLLGSASTNWTS
VAGSYGYMAPELAYTMRVTEKCDVYSFGVVALEVMMGKHPGDLLTSLPAISSSQQDDLLL
KDILDQRLDPPKEQLAEEVVFIVRIALACTRVNPESRPTMRSVAQEISAHTQAYLSEAFK
LITISKLTDYQK
Download sequence
Identical sequences I1I4K3
XP_003574033.1.954 EG:BRADI3G28380.1 15368.BRADI3G28380.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]