SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G28930.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G28930.1
Domain Number 1 Region: 7-148
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 1.83e-30
Family Staphylococcal nuclease 0.0058
Further Details:      
 
Domain Number 2 Region: 580-713
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 9.15e-29
Family Staphylococcal nuclease 0.0015
Further Details:      
 
Domain Number 3 Region: 180-229,273-367
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 4.84e-26
Family Staphylococcal nuclease 0.0022
Further Details:      
 
Domain Number 4 Region: 375-457,506-557
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 3.14e-21
Family Staphylococcal nuclease 0.017
Further Details:      
 
Domain Number 5 Region: 774-855
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.91e-17
Family Tudor domain 0.0035
Further Details:      
 
Domain Number 6 Region: 817-972
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 9.42e-16
Family Staphylococcal nuclease 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G28930.1   Gene: BRADI3G28930   Transcript: BRADI3G28930.1
Sequence length 987
Comment pep:novel chromosome:Brachy1.0:3:30693343:30699817:1 gene:BRADI3G28930 transcript:BRADI3G28930.1
Sequence
MASNTGASGWLRGKVKGVTSGDCLLIMGSTKAEIPPEKSITLSYLMAPRLARRSGVDEPF
AWESREFLRKLCVGKEVTFRVDYTAPNVGREFGTVYLGDKNVAYSVVAAGWARVKEQGPK
GGEQSPYLAELQRLEEVAKQQGLGRWSKEPGAAEESIRDLPPSAIGESSGFDSKGFAVAN
KGKSLEAIVEQVRDGSTIRVYLLPSFQFVQIYVAGVQAPSMGRRPPNPTVVAEVEGTADG
TTNGDDSVESPAPLTTAQRLAASAVSTEIPPDRFGREAKHFTETRVLNRDVRIVVEGTDS
FNNIIGSVYYPDGDTAKDLSLELVENGLAKYVEWSANMLDVEVKIKLKNAELQAKKDQLR
IWTGFKPPATNSKPIHDQKFTGKVVEVVSGDCIIVADDAAPYGSPTAEQRVNLSSIRAPK
LGNPRREDNKPANFARESKEFLRTRLIGKQVTVEMEYSRRISTVDGQNAAPTTNMADTRV
LDYGSVFLGSPAGGDDTSSIPNTGNQPRINVAELLLSRGFAEISKHRDYEERSHYFDALL
AAHSRAEKAKKGLHSDKLSPVMHITDLTMVSAKKAKDFLPFLQRNRRQSAIVEYVFSGHR
FKLTIPKETCSIAFSLSGVRCPGKDEPYSSEAIALMRRMILQRDVEIEVETVDRNGTFLG
SLWESKTNISSVLLEAGLAKLSSFGLDRIADAHVLTKAEQSAKQQKLKIWENYVEGEEVS
NGSASESKQKEILKVVVTEVLGGGKFYAQTVGDQRVSSIQQQLASLKLKEAPVIGAFNPV
KGEIVLAQFSLDNSWNRAMIVNGPRGAVESVDDKFEVFYIDYGNQEVVPYSRIRPADPSV
SSSPALAQLCSLAFIKVPGLEDDYGQEAAEYLSECLLSSSKQFRAMIEERDVSGGKSKGQ
GTGATLIVTLVDAETESSINAAMLEEGVARLERSKRWDTRERKTALQNLEQFQEKAKKER
LRLWQYGDVESDEEEQAPGARKPGGRR
Download sequence
Identical sequences I1I4R5
15368.BRADI3G28930.1 XP_003574069.1.954 EG:BRADI3G28930.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]