SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G29247.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G29247.1
Domain Number 1 Region: 647-713
Classification Level Classification E-value
Superfamily FF domain 0.00000000000000667
Family FF domain 0.00035
Further Details:      
 
Domain Number 2 Region: 780-845
Classification Level Classification E-value
Superfamily FF domain 0.0000000000000785
Family FF domain 0.0014
Further Details:      
 
Domain Number 3 Region: 712-779
Classification Level Classification E-value
Superfamily FF domain 0.00000000017
Family FF domain 0.0033
Further Details:      
 
Domain Number 4 Region: 946-1017
Classification Level Classification E-value
Superfamily FF domain 0.00000000262
Family FF domain 0.0029
Further Details:      
 
Domain Number 5 Region: 435-469
Classification Level Classification E-value
Superfamily WW domain 0.000000138
Family WW domain 0.003
Further Details:      
 
Domain Number 6 Region: 487-518
Classification Level Classification E-value
Superfamily WW domain 0.000000208
Family WW domain 0.0025
Further Details:      
 
Domain Number 7 Region: 880-949
Classification Level Classification E-value
Superfamily FF domain 0.000000314
Family FF domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G29247.1   Gene: BRADI3G29247   Transcript: BRADI3G29247.1
Sequence length 1041
Comment pep:novel chromosome:Brachy1.0:3:31142309:31154312:-1 gene:BRADI3G29247 transcript:BRADI3G29247.1
Sequence
MATPAVVSSDEDNSPTAEHPRPESAAPVAEASGPGAAAAAAAAAAVERTAAGDAPSAPAP
PSTSSATLPPPPASPASHAAPGPPRPPFAGSAAYVTPPSSSSSAAFSYNILPRAPPPRQA
SPMPPAALQPPAPQQYFGNRPSFSYNVVSHANASLPTGQQFQLDTGTNRAVQVPMFAPPA
SLQPPAPGQLPRPSAPFPGAMTPNLPGSIRSPFPVPPRTSNILYGSNPQQGNLDASASKL
DAPSASEASPHTMQSLPASGPEVFGAVGGFVPGQRSSNLSAPPSLLGRPVAPSASSLPQT
SPSGAAPGAVPQTTQQQFYPSYPSAPGIVPPQPLWGYPPHPTSFLQSPFQSYPPGPLGPL
GRPMVGTSAVTTSVTNIQPPGVTTIGGDPKELPPANPGSEQPLHTSAVPHPTGHGNQVND
QLEDKRSTGIQDSDAWSAHKTEAGVLYYYNALTGESTYQRPPGYMGELEKVAAQPVPASW
DKIVGTDWSIVTTSDGKKYYYDNKQKVSSWQLPPEVAELNKNADSGSLKGNSSLHDAGTV
GNKGETGVEISTPAIQTGGRDSLPLRQAVASASPSALDLIKKKLQDAGASSLSSPLATPS
STASELNGSKPADGAPKGQQGSINGEKPKDNNGNGNMSDSSSDSDDEEHGPSKEDCIREF
KEMLKERGVAPFSKWEKELPKLVFDPRFKAIPSHSTRRTIFDHFVRTRADEERKEKRAAQ
KAAVEAYKQLLEEASEDIDPKTGYQEFKRKRGTDPRFEGLDRKEREALFKEKVRAIEEKV
QSVRNALITDFKSMLRECKDIISTSHWTKVKEHIRSDPRYKAVKHEERENVFNEYIAELK
SAEREVEQAAKAKVDEQAKLRERERETRKRKEREEQEMERVKLKIRRKDAVSSYQALLVE
IIKDPKASWTESKPKLDKDPQGRALNPDLGQGDAEKLFRDHVKDLYERCVRDFRALLSEV
ITQEIAARTTDEGKTAISSWSEAKGLLRSDPRYNKVSSKDRESIWRRYADDMARKLKQSD
TEKLDTDGRQQRRSSDPPRRR
Download sequence
Identical sequences I1I4V3
XP_010234841.1.954 EG:BRADI3G29247.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]