SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G29700.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G29700.1
Domain Number 1 Region: 39-788
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.49e-278
Family Motor proteins 0.0000000000257
Further Details:      
 
Domain Number 2 Region: 789-886
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.19e-16
Family Motor proteins 0.079
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G29700.1
Domain Number - Region: 925-1028
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0157
Family Myosin rod fragments 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G29700.1   Gene: BRADI3G29700   Transcript: BRADI3G29700.1
Sequence length 1514
Comment pep:novel chromosome:Brachy1.0:3:31730873:31754747:-1 gene:BRADI3G29700 transcript:BRADI3G29700.1
Sequence
MEILLQGSIARFTVGSHVWVEDADVAWIDGLVEEVNGDNLTVNCTSGKKVTANVSSVYPK
DVEVKRCGVEDMTRLAYLHEPGVLRNLKSRYGMNEIYTYTGNILIAVNPFQRLPHLYNDH
MMGMYKGAEFGELSPHPFAIADRAYRLMMNYGISQAILVSGESGAGKTESTKMLMQYLAF
MGGKVESGGRSVQQQVLESNPVLEAFGNAKTVRNNNSSRFGKFVELQFDQNGKISGAAIR
TYLLERSRVCQISDPERNYHCFYMLCAAPPEDRERYKLGDAASFHYLNQSNCIKLDGMDD
SSEYIATRRAMEIVGISSDEQDAIFRVVAAILHLGNVDFSEGSEADSSVPKDEKSQFHLR
TAAELFMCDEKSLEESLCKRVMVTRGESIVRNLDSRGAALSRDALARIVYSRLFDWLVNK
INTSIGQDPTSKLLIGVLDIYGFESFKTNSFEQFCINLTNEKLQQHFNQHVFKMEQEEYT
KEEIDWSYIQFVDNQEILDLIEKKPGGIISLLDETCMLRNSNHEIFAEKLYQKFKDNPHF
SRPKFSRSDFTIHHYAGNVTYQTDLFLDKNIDYAVNEHQDLLHASRCPFVSSLFPPSEES
TKSTKFTSIGSSFKQQLQALLETLSTTEPHYMRCIKPNNVLKPAIFENSNVLQQLRCGGV
LEAIRISCLGYPTRRTFDEFVDRFGILLPEVLGESYDEVTATNMLLEKVNLTGYQIGKTK
VFLRAGQMAELDARRTEVLNCSASKIQRKVRSYLARRNFIELRMSSTQLQAICRGQIARF
HYEDLRRKAASLKIQTYYRMHFARKNYRDICSASTTIQSGLRGMAARRELHFRQQTKAAV
IIQSCCRSDLASSRYMGLKKAAITTQCAWRGRVARRELRKLKMAAKESGALQAAKNKLEK
QVEELTWRLQLEKRMRTDMEEAKTQENRKLQQKVQELQLQSKETKDLLKREQENAKTAWE
KAALVPEIHADTTLVDELTAENEKLKTLVVSLETKIDETEQKFEEMKNAREELLKKAIDA
ESKINGLTNTMLSFQEKMTNMEAENQLLRQQALLRTPVRTIPENTSPKSNLTNGSPHSEE
QMTPHGTPRAPKDYGNLAQPRASFFERQHESVDALIDCVAENVGFSEGKPVAAITIYKCL
VHWKIFETEKTSVFDRLIQIFGSAMQNHDSNEDLAYWLSNSSTLLIILQKSLKAVGSSGT
TPRKRPQPQSSFLGRMVFRSSTITVDMDLVRQIEAKYPAFLFKQQLAAFVEGLYGMIRDN
VKKELSSLLLHAIQVPRIMKASMVRGHSFGSSTLPRGRSFSNQGSYWQAIVDNLNELLNI
LRENCVPAIFIRKIFTQLFSFINAQLFNSLLVRHECCSFSNGEYVKQGLAQLEVWCGEVK
PEYAGSALDELRHIRQAVGFLVIFKKFRISYDEIVHDLCPVLSVQQLYKICTQYWDDKYN
TESVSEEVLDEMRTLMTEESSHSTSDSTFLLDDEISMPISLEEIADSMDVKEFQNVAPPS
ELVAVPAFQFLRSR
Download sequence
Identical sequences I1I502
EG:BRADI3G29700.1 15368.BRADI3G29700.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]