SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G30757.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G30757.1
Domain Number 1 Region: 432-637
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.22e-36
Family ABC transporter ATPase domain-like 0.00013
Further Details:      
 
Domain Number 2 Region: 138-333
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.00000000654
Family DNA repair protein MutS, domain III 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G30757.1   Gene: BRADI3G30757   Transcript: BRADI3G30757.1
Sequence length 681
Comment pep:novel chromosome:Brachy1.0:3:32945390:32956609:-1 gene:BRADI3G30757 transcript:BRADI3G30757.1
Sequence
MLRLSTTLSLLSLASLSPHHPRRLVRLRALAPAASSSPSARSLCLLEWGKVCRAVASFAG
TAHGREATEKQLWGVEDVSYERSRRLLQETEAAVRLLGTSGGSFDFSGLDTVTVEAAIQC
VSGGSVIKGQEAMAVVSLMLFVESLQVTIRAAMRQDEESHNLLMPLTETILEAVVNKSLV
KSIQDIIDDDGSVKDTASPELRRYREQVQSLESRLCQLMDRLIRNSDSEASLSEVSIVNG
RCCIKVTGDKSLSFDGLLLSSGSDAGSMIEPIVAVPLNDELQGARALVARAELDALSKLT
DKILLELDNIQILLQETITLDKVTARAKYSIAYDGTLPDLYLPKFEHETVNTATDWPVSA
TSSAQLPKKPWKVFIPNAFHPLLLQQHQENLRRIKKDVASATAEIRRRRIYGQDIAEEDQ
LASDLDSMKNRVSKLERNHPIPVDFMIGEETTVLVITGPNTGGKTISLKTVGLASLMAKI
GLYILASEPVKIPWFDAVYADIGDEQSLTQSLSTFSGHLKQIGAIRAQSTSQSLVLLDEV
GAGTNPLEGAALGMSLLESFAEAGSFLTLATTHHGELKTLKYSNDSFENACVEFDEENLK
PTFRILWGIPGRSNAINIAERLGLPLDIIESARHLLGTAGAEINALIMDMEKFKQEYDEQ
LQQAQHYLMFIRPVRISISSI
Download sequence
Identical sequences I1I5D7
EG:BRADI3G30757.1 XP_010234908.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]