SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G31090.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G31090.1
Domain Number 1 Region: 149-268
Classification Level Classification E-value
Superfamily TPR-like 9.86e-16
Family Tetratricopeptide repeat (TPR) 0.005
Further Details:      
 
Domain Number 2 Region: 364-469
Classification Level Classification E-value
Superfamily PH domain-like 0.0000577
Family Pleckstrin-homology domain (PH domain) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G31090.1   Gene: BRADI3G31090   Transcript: BRADI3G31090.1
Sequence length 485
Comment pep:novel chromosome:Brachy1.0:3:33239683:33246695:1 gene:BRADI3G31090 transcript:BRADI3G31090.1
Sequence
MEQPGPTDGGEDVPNGAGGRAPPAPVEVVVEEEAGEDEEEPPRPATAKQEEAKAGLGAEG
SRPFTMRELLGEIKEDNEAADGSGGGALGSALPEGNGTGSADVEGSSSSQESTQQFQSHH
DVAMDLINSVTGVDEEGRSRQRILSFAGKRYVNAIERNPDDPDAYYNWALVLQESADNAD
PSSGSSKDALLEEACKKYAEATLLCPTLYDAYYNWAIAIADRAKMRGRTKEAEDLWKQAI
LNYEKAVQLNWNSPQALNNWGLGLQELSAIVPAREKQTIIKTAISKFRVAIQLQFDFHRA
IYNLGTVLYGLAEDTMRSGRPDASPNELYSQSAIYVAAAHSLKPNYSVYRSALRLVRSML
PLPYLKVGYLTAPAVDNAIAPHKNWERSQFVLNHEGLLQSDASDQPPSQSRKPFWIAVAD
IVSVSASADLTLPPGAGLCIDTVQGPRFLVADSWDALDGWLDALCLVYTIFARGKSDVLA
GIVTG
Download sequence
Identical sequences I1I5F7
EG:BRADI3G31090.1 15368.BRADI3G31090.1 XP_003574202.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]