SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G33020.3 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G33020.3
Domain Number 1 Region: 327-703
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.83e-111
Family Oxysterol-binding protein 0.0011
Further Details:      
 
Domain Number 2 Region: 30-142
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000112
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G33020.3   Gene: BRADI3G33020   Transcript: BRADI3G33020.3
Sequence length 713
Comment pep:novel chromosome:Brachy1.0:3:35391058:35397212:1 gene:BRADI3G33020 transcript:BRADI3G33020.3
Sequence
MRAREMHPLCCLAGAAEYCPGGGAGDRSPPPPPAPALDGAPAAVAGVLYKWTNIGSGWRP
RWFAIRGGVLAYSKIRRRVAAEETPPPPRHEAAGISSFSESKSDDKRFYIITPTKTLQLR
TGCAKDRVAWIEALVSARSEYSLCGVLPCDQNDGSFSTEKLRDRLHAEGVGASIVKDCEQ
IVHSEFSQYHTQMKQRCESYLSFIGSLPRELEVVNSGDATIVDNLELQLFKPDCSSSGKC
SEYSNTESSDDAVKQEICQVSDEDEFHFYDTRQSFSDCTASPDFKTRHLDHGNEAHKFAN
LLAADRTNEYSLSSSKRRSKLPEPVEKEKSVSLWSMIKDNVGKDLTRVCLPVYFNEPLSS
LQKCFEDLEYSYLLDRAYECGVRGNGLMRILYVAAFAVSGYASTDSRPCKPFNPLLGETY
EADYPEKGIRFFSEKVSHHPMAMACHCEGKGWKFWGDSNLKSKFWGQSIQLDPSGVLTLE
FDDGETFQWSKVTTTINNLIIGRVYCHHHGTMNIRGNRQYSCKLMFKEQSFLERNPRQVQ
GFVKYSDGTKVASLMGKWDESMYCIISDDASKVSSHVSHQSAGTTLLWEKNEPPDNPTRY
NLSSFAITLNELTPGLKLPPTDSRLRPDQRHLENGEYEKANAEKLRLETRQRMARNMQES
GWRPRWFQRDAEDGTYRYVGGYWEAREQRRWVGCNDIFGNFTDTPKLHTGATV
Download sequence
Identical sequences I1I617
EG:BRADI3G33020.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]