SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G33722.3 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI3G33722.3
Domain Number - Region: 67-209
Classification Level Classification E-value
Superfamily Caspase-like 0.000136
Family Gingipain R (RgpB), N-terminal domain 0.054
Further Details:      
 
Domain Number - Region: 3-34
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0256
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G33722.3   Gene: BRADI3G33722   Transcript: BRADI3G33722.3
Sequence length 278
Comment pep:novel chromosome:Brachy1.0:3:36076912:36079257:1 gene:BRADI3G33722 transcript:BRADI3G33722.3
Sequence
MMMLVNCSGCRTPLQLPHGAPCIRCAICGAVTHVAAPPAAAPSPDPARGAVAPSWGPPPP
AAHGRKRAVICGISYRFSRHELKGCINDAKCMRHLLTTRFSFPDDSIIMLTEEQTDPYKI
PTKHNIRMAMYWLLQGSQPGDSLVFHYSGHGAQQRSYSGDEVDGMDETLCPLDFETQGMI
VDDEINAALVRPLPHGAKLHALIDACHSGTALDLPFLCRMNRSGQYIWEDHRPRSGVWKG
TSGGEAISFSGCDDNQTSADTSVSSDLIQSVLFVVIIV
Download sequence
Identical sequences I1I698
EG:BRADI3G33722.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]