SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G34470.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G34470.1
Domain Number 1 Region: 799-1091
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.18e-73
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 272-581
Classification Level Classification E-value
Superfamily RNI-like 1.1e-56
Family Rna1p (RanGAP1), N-terminal domain 0.053
Further Details:      
 
Domain Number 3 Region: 61-322
Classification Level Classification E-value
Superfamily L domain-like 8.33e-52
Family Polygalacturonase inhibiting protein PGIP 0.0014
Further Details:      
 
Domain Number 4 Region: 542-711
Classification Level Classification E-value
Superfamily L domain-like 1.13e-30
Family Polygalacturonase inhibiting protein PGIP 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G34470.1   Gene: BRADI3G34470   Transcript: BRADI3G34470.1
Sequence length 1117
Comment pep:novel chromosome:Brachy1.0:3:36864147:36867898:1 gene:BRADI3G34470 transcript:BRADI3G34470.1
Sequence
MGLLLSNWFFLFFAFVSSSWSLNLDGQALLALSKNLILPSSISYSWNASDRTPCNWIGIG
CDKKNNVVSLDLSSSGVSGSLGAQIGLIKYLEVISLPNNNISGPIPPELGNCSMLDLLDL
SGNFLSGEIPESLGNIKKLSSLWLYNNSLNGEIPERLFNSKFLQDVYLQDNSLSGSIPSS
IGEMTSLKYLWLHYNALSGVLPDSIGNCSKLEDVYLLYNRLSGSIPKTLSYVKGLKNFDA
TANSLNGEIDFSFENCKLEKFILSFNQIRGEIPPWLGNCSRLTELALVNNSLSGHIPASL
GLLSNLSRLLLSQNSLSGPIPPEIGNCRLLLWLEMDANMLVGTVPKELANLRNLQKLFLF
DNRLTGEFPEDIWSIKRLESVLIYRNGFTGKLPLVLSELKFLQNITLFDNFFTGVIPPGL
GVNSRLIQIDFTNNSFTGAIPPNICSGQSLRVFVLGFNLLNGSIPSGVVNCPSLERIILQ
NNNLTGPIPQFRNCANLDYMDLSHNSLSGDIPASLGGCINITKINWSDNKLFGPIPREIG
KLVNLRFLNLSQNSLLGELPVQISRCSKLYYLDLSFNSLNGSALMTVSNLKFLLQLRLQE
NKFSGGLPDSLSQLHMLIELQLGGNILGGSIPASFGKLIKLGVALNLSRNGLVGDIPTLL
GDLVELQSLDLSFNNLTGGLATLGGLRLLNALNVSYNRFSGPVPEYLMKFLDSMASSFRG
NSGLCISCHASDSSCKRSNVLKPCGGSEKRGVHGRFKVALIVLGSLFFAALLVLILSCIL
LKTRASKTKSEKSISNLLEGSSSKLNEVIEMTENFDAKYIIGKGAHGIVYKATLRSGEVY
AIKKLAISTRNGSYKSMIRELKTLGKIRHRNLIKLKEFWLRSECGFILYDFMEHGSLYDV
LHGVGPTPNLDWSVRYNIALGTAHGLAYLHHDCIPAIIHRDIKPSNILLNKDMVPRISDF
GIAKIMDQSSAAPQTTGIVGTTGYMAPELAFSTRSSIETDVYSYGVVLLELITRKMAVDP
SFPDNMDIARWVHHALNGKDQVAVVCDPALMDEVYGTDEMEEVRKVLSLALRCAAKEAGR
RPSMIDVVKELTDARAAAISSSKQAKQGSRRVACPDG
Download sequence
Identical sequences I1I6I7
EG:BRADI3G34470.1 15368.BRADI3G34470.1 XP_010235056.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]