SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G35137.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G35137.1
Domain Number 1 Region: 665-954
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.69e-69
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 72-351
Classification Level Classification E-value
Superfamily RNI-like 5.65e-57
Family Cyclin A/CDK2-associated p19, Skp2 0.036
Further Details:      
 
Domain Number 3 Region: 304-570
Classification Level Classification E-value
Superfamily L domain-like 4.08e-45
Family Polygalacturonase inhibiting protein PGIP 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G35137.1   Gene: BRADI3G35137   Transcript: BRADI3G35137.1
Sequence length 978
Comment pep:novel chromosome:Brachy1.0:3:37458203:37461508:1 gene:BRADI3G35137 transcript:BRADI3G35137.1
Sequence
MTPLLLLFLLLCTPATPAASLAADFSVLLAAKDALSDPASALSAWRTPSPLSPCRWPHIL
CSSSDDDPTIASLLLSNLSLAGEFPKPLCSLSSLVRLDLSYNSLTGPLPPCLAELQSLKH
LNLAGNSFTGEIPRSFGAGFPSLSTLNLAGNDISGEFPAFLANVSALEELLLAYNPFTPS
PVPDAIAHGLPRLRVLWLAGCGLVGNIPASIGNLKRLVNLDLSTNNLTGEIPESIGGLES
VVQIELYSNKLSGRVPAGLGKLKKLRFLDVAMNRLSGEIPPDLLLAPGLESLHLYENELS
GRVPSTLGQAPALNDLRLFSNRLVGELPPEFGKNCPLEFIDLSDNRISGRIPATLCSAGK
LEQLLILNNELDGPIPAELGECRTLTRVRLPNNRLSGPVPLDMWSLPHLYLLELAGNALS
GTVGPGIALAQNLSQLLLSDNHFAGVLPAELGSLTNLVELSAANNGFSGPLPATLADLST
LGRIDLRNNSISGELPQGVRRWQKLTQLDLADNRLTGSIPPGLGELPVLNSLDLSSNELT
GGVPAQLENLKLSLLNLSNNRLSGDLSPVFSGDMYDDSFLGNPALCRGGACSGGRRGAGA
AGRRSAESIITIAGVILVLGVAWFCYKYRSHYSAEASAGNKQWVVTSFHKAEFHEEDILS
CLHDEHNVIGAGAAGKVYKAFLGRGGDEDVVAVKKLWGAARNKELSSSSSSSNKDGFEAE
VATLGRVRHKNIVKLWCCLRSGDRRLLVYEYMPNGSLGDLLHGGKGAVLDWPMRYRIMVD
AAEGLSYLHHDCAPPIVHRDVKSNNILLDADFGAKVADFGVARAIVGSGNNGRRAPDAAV
SAIAGSCGYIAPEYSYTLRITEKSDVYSFGVVMLELVTGKRPVGGPELGDKDLVRWVCGS
IEREGVDAVLDPRLAAGAGESCRAEMRKVLSVALLCTSSLPINRPSMRSVVKLLLEVLPD
SKPALVLELEEKPPLDVV
Download sequence
Identical sequences I1I6S7
EG:BRADI3G35137.1 XP_003572165.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]