SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G36167.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G36167.1
Domain Number 1 Region: 40-317
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.51e-28
Family G proteins 0.00083
Further Details:      
 
Domain Number 2 Region: 548-667
Classification Level Classification E-value
Superfamily PH domain-like 2.28e-17
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G36167.1
Domain Number - Region: 47-70,411-479
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0907
Family Nucleotide and nucleoside kinases 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G36167.1   Gene: BRADI3G36167   Transcript: BRADI3G36167.1
Sequence length 759
Comment pep:novel chromosome:Brachy1.0:3:38407513:38420782:1 gene:BRADI3G36167 transcript:BRADI3G36167.1
Sequence
MEAMEELSELADATIQASGLLADDDDDPADRSPRRGGSSFLTVVALGNVGAGKSAVLNGL
IGHPVLPTGENGATRAPVCVDLQRDASLSSKTIVLRIDSKSQQVSASSLRHSLQDRLSKA
VSSGKGRSDEINVKLCTSTAPPLKLIDLPGIDQCSIDESVIGNLVVRSDAILLVIIPALQ
APDVASSRALRLARELDTEGTRTIGVLSKVDQAAGEQKALGAVQALLANQGPRTAKDIHW
IATIGHYVPIASSQSGGGSETSPETSWQAEAESLLSILGGAPHSKLGRVALLDSFSKQIR
TSIKVRLPNLLIGLQGKSQIIQDELAKLGEQMVQSSEGTRVIALGLCREFEDRFLQHIAG
GEGAGWKVVASFEGKFPTRVKQLPLDKHFDMKNVKRIVLEADGYQPYLISPERGLKSLIK
GLLELAKEPSTLLVDEVHRVLLDIVSAAANATPGLGRYPPFKREVIAIASAALDGFKNEA
KKMVIALVDMERVFVPPQHFIRLVQKSYPTLKDIVTIILLMEVPGVCVKVTTCHHKNDIL
AKHYSYQHGFLFKKRAKGNDWSKRWFVLNEKSGKLGYTKKQEERHFRGVINLEECNLEEV
LEEEDPPRSSKDSKRASGPDFEKAPDLIFKITNKVAYKLVLKAHSTIILKAESMADKTEW
VTRIKSITAKRTNVSEGGLQMRESHSDSSLVSVSKKDSSLDTMLRKPVDPEEELRWISQE
VRGYVEAVLSSLAANVPKLWFFSKLRRQRKTCLISSILP
Download sequence
Identical sequences I1I754
EG:BRADI3G36167.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]