SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G36860.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G36860.1
Domain Number 1 Region: 61-197
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.0000545
Family NRPS condensation domain (amide synthase) 0.064
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G36860.1
Domain Number - Region: 306-354
Classification Level Classification E-value
Superfamily EutN/CcmL-like 0.0471
Family EutN/CcmL-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G36860.1   Gene: BRADI3G36860   Transcript: BRADI3G36860.1
Sequence length 439
Comment pep:novel chromosome:Brachy1.0:3:39215903:39219141:1 gene:BRADI3G36860 transcript:BRADI3G36860.1
Sequence
MKVEVVESTLVAPSEETPRQALWLSNLDLAVPKTHTPLVYYYPAPPPPPPGAGDGDEDDG
GFFSPDRLRAALAKALVLFYPLAGRLGVDGAGGGRLQIDCNGEGALFNVARADFAGDDVF
REYEPSPEVRRMFVPLAPSGDPPCLMAMFQVTFLKCGGVVLGTGIHHVTMDGMGAFHFIQ
TWTGLARGLPVSEACPNPPSHDRTLLRARSPPTPEFEHPVYSPAFLNGAPRPFVTRVYNV
SPKLLAGLKAQCAPGASTYGAVTAHLWRCTCVARGLAQRSDTRLRVPANVRHRVRPPLPR
QLFANAIVRDLVTAKAGDVVAQPLGFVADAIRKAVDHVDDAYVRSVVDYLETESEKGSNA
ARGTMMPESDLWVVSWLGMPMYDADFGWGAPRFVAPAQMFGSGTAYVTQRGPDREDGVAV
LFALEPEYLQSFEDVFYGE
Download sequence
Identical sequences I1I7E1
EG:BRADI3G36860.1 15368.BRADI3G36860.1 XP_003574533.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]