SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G37600.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G37600.1
Domain Number 1 Region: 83-396
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-80
Family Protein kinases, catalytic subunit 0.0000841
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G37600.1
Domain Number - Region: 385-440
Classification Level Classification E-value
Superfamily Prefoldin 0.0288
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G37600.1   Gene: BRADI3G37600   Transcript: BRADI3G37600.1
Sequence length 479
Comment pep:novel chromosome:Brachy1.0:3:40104265:40106471:-1 gene:BRADI3G37600 transcript:BRADI3G37600.1
Sequence
MASSNSWKSSLFCCVGGGGGAMAGDEEGPSPSSTPRQRRGHRRTLLSSAASSASASRLSL
SSLGSTGTLTPEDLSVTLSGSNLHAFTYAELRAVTGGFSRANYLGCGGFGPVYKGRVSDE
LRPGLQAQPVAVKYLDLDCSTQGHKEWLAEVFFLGQLRHKNLVKLIGYCYEDEHRMLVYE
YMGNGSLEKHLFKSLDGSMPWITRMRIAVGAAKGLAFLHDADTPVIFRDFKASNILLDED
YNSKLSDFGLAKDGPQGDATHVTTRIMGTHGYAAPEYIMTGHLTAKSDVYSFGVVLLELL
SGRRSIDRARRSREQSLVDYARPYLKKPEKLYRIMDPALEGQYSCKGAEQAAQVAYKCLS
QNSKSRPTMREVVKSLEPILDMDDYLQVGPFVFTVVVEDVNKNNESKTKLIDGERKVDVR
VETAMEEKHQSHQDRYRQKFPNSAIHANIVLHRDGAIGSYTAALRRHRRASSYSEERGA
Download sequence
Identical sequences I1I7M6
XP_003572269.1.954 EG:BRADI3G37600.1 15368.BRADI3G37600.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]