SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G39150.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G39150.1
Domain Number 1 Region: 218-526
Classification Level Classification E-value
Superfamily L domain-like 2.92e-63
Family Internalin LRR domain 0.058
Further Details:      
 
Domain Number 2 Region: 768-1054
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.45e-58
Family Protein kinases, catalytic subunit 0.0007
Further Details:      
 
Domain Number 3 Region: 26-305
Classification Level Classification E-value
Superfamily L domain-like 7.82e-54
Family Polygalacturonase inhibiting protein PGIP 0.0019
Further Details:      
 
Domain Number 4 Region: 450-686
Classification Level Classification E-value
Superfamily L domain-like 3.03e-49
Family Polygalacturonase inhibiting protein PGIP 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G39150.1   Gene: BRADI3G39150   Transcript: BRADI3G39150.1
Sequence length 1115
Comment pep:novel chromosome:Brachy1.0:3:41536224:41540004:1 gene:BRADI3G39150 transcript:BRADI3G39150.1
Sequence
MPPPRLRGAIATWHLLLLACVLPLALCANEQGEALLRWKRSLSTNGSSGVLGSWSSSDVS
PCRWLGVGCDASGKVVSLSLTSVDLGGAVPASMLRPLAASLQTLALSNVNLTGAIPAELG
ERFAALSTLDLSGNSLTGAIPASLCRLTKLRSLALHTNSLTGAIPADIGNLTALTHLTLY
DNELGGTIPASIGRLKKLQVLRAGGNPALKGPLPAEIGQCSDLTMLGLAETGMSGSLPDT
IGQLGKLQTLAIYTTTLSGPIPATIGNCTELTSLYLYQNALTGGIPPELGQLTKLQNVLL
WQNNLVGHIPPEIGNCKELVLIDLSLNALTGPIPSTFGALPKLQQLQLSTNKLTGAIPAE
LSNCTALTDVEVDNNELSGDIGAMDFPRLRNLTLFYAWQNRLTGRVPPGLAQCEGLQSLD
LSYNNLTGPVPRELFALQNLTKLLLLSNELSGIIPPEIGNCTNLYRLRLNENRLSGTIPP
EIGKLKSLNFLDLGSNRLEGPVPSAIAGCDNLEFVDLHSNALSGAMPDELPKRLQFVDVS
DNRLAGVLGPGIGRLPELTKLSLGKNRISGGIPPELGSCEKLQLLDLGDNALSGGIPPEL
GTLPFLEISLNLSCNRLTGEIPSQFGGLDKLASLDVSYNQLSGALAALAALENLVTLNVS
FNAFSGELPDTPFFQKLPLSNIAGNDHLVVVGGGDGESQSASSRRAAAMSALKLGMTILV
AVSAFLLVAATYVLARSRRRSFEEEGRAHGGEPWEVTLYQKLDFSVDEVARSLTPANVIG
TGSSGVVYRVVLPNGDPLAVKKMWSASSDGAFANEISALGSIRHRNIVRLLGWAANRSTK
LLFYAYLPNGSLSGFLHRGAAVVKGGGGGAADWDARYEVALGVGHAVAYLHHDCLPAILH
GDIKAMNVLLGAGNEPYLADFGLARVLSGAVLPGASAKLDTSKHRIAGSYGYIAPEYASM
QRITEKSDVYSYGVVVLEMLTGRHPLDPTLPGGAHLVQWVRDHAQGKRELLDPRLRGKPE
PEVQEMLQVFAVAMLCVGHRADDRPAMKDVVALLKEVRRPPDGAAGDEGKGQGCGGAAAA
PDAVAGERRLRSPARSVLPMGGSSNCSFAMSDYST
Download sequence
Identical sequences I1I867
15368.BRADI3G39150.1 XP_003572332.1.954 EG:BRADI3G39150.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]