SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G40370.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G40370.1
Domain Number 1 Region: 413-632,676-703
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.68e-38
Family Protein kinases, catalytic subunit 0.00078
Further Details:      
 
Domain Number 2 Region: 63-223
Classification Level Classification E-value
Superfamily L domain-like 4.08e-24
Family Polygalacturonase inhibiting protein PGIP 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G40370.1   Gene: BRADI3G40370   Transcript: BRADI3G40370.1
Sequence length 743
Comment pep:novel chromosome:Brachy1.0:3:42528364:42530595:1 gene:BRADI3G40370 transcript:BRADI3G40370.1
Sequence
MAGAPPPLLLLTTSCVLLALLHAAGAARLLLAAPGDADALLKLKAGIDDGGSGVLQSWAA
GTSPCDGDASNWAGVMCHKGDVMGLQLENMGLSGKLDLGTLATLRGLRTLSFMDNHFAGP
MPDIRDLDGLRAVFFSGNGFSGQIPADAFDGMGSLKKVYLGNNSFFGPIPASLAGMPRLL
ELRLNDNGFQGKIPDLPQKELKVVDVANNDLEGEIPPSLKSMNPAMFAGNKKLCGGSLGT
KCSAPPTSPSPPAPEKAGTPSTPATPATPTPAVPQPDEKPTQNDAEKPTERSLSAGVLVA
LVGVLAIVGFALLALQRRREYNTENFGPAMSKKPSMRKINAEPAKLDTASAHADAPSPET
AAAAAAAGGSSRAGGAARKAGAEQGRLTFVREDRGRFFELQDLLKATAEILGGSGNLGVC
YRATLSGGEVSIVVKRFKEMNRVGREDFEEHMRRLGRLSHRNLLPLVAYYYRKEEKLLMH
DYVPKRSLAHLLHGEGRGVKKAVVHWNARLKIVKGVARALGYMYDELPMLTVPHGHLKSS
NILLNEEFEPLLTDYALVPVMNQSHAAQLMVAFKSPERKQFGKSSKKSDVWCLGLLILEV
VTGKPPSYDTKPAATTGDSSGADQQPPQKQKSSAGSSANAVDLAGLVASTAEEEWLRTVV
DGDMKYDEEEEGEEVVKLIRIGMACCEGNVESRWELKNAVERIEELKGKDRRGPGNEDNS
FYSSVSGDGVADRDEDFGNVGIH
Download sequence
Identical sequences I1I8L1
15368.BRADI3G40370.1 XP_003574774.1.954 EG:BRADI3G40370.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]