SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G42680.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G42680.1
Domain Number 1 Region: 188-478,519-638
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.35e-117
Family Myotubularin-like phosphatases 0.000000128
Further Details:      
 
Domain Number 2 Region: 31-153
Classification Level Classification E-value
Superfamily PH domain-like 1.54e-18
Family GRAM domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G42680.1   Gene: BRADI3G42680   Transcript: BRADI3G42680.1
Sequence length 827
Comment pep:novel chromosome:Brachy1.0:3:44152792:44161426:-1 gene:BRADI3G42680 transcript:BRADI3G42680.1
Sequence
MEASGSWDAIDWNQIEDPRSRRSSQGMEEFLLEDEEVHAQGHGVVLLNTDEAGTVSVTNF
RLLFVSQATKSVVELGTIPLTTIEKLNDDVKLQSLPRQYDKKQPRELLQVIGKDMRVIVF
AFRPRTKQKNEVFDTLRRYTKPAHLWDLYAFSCDPSTVDKKSDPKLRLLKEYHRLFRKWF
SHSSSSGLEVEKDSLRNAWWRVTSVNSNYSLCSTYPSQLIVPRSISDEDLWQASTFRAGK
RLPIISWCDPESGAVLARSSQPMVGLMMNFRNNSDEKLVSALCTQTDATGSPRKLYIVDA
RPRANALANGAKGGGSESSSNYPKSEVLFLGIQNIHTMRDSLSRLRDYVDAHGSISSNGS
SSAVSLVGDRRNRGSTWGGGNLNSMTQFSSMLGEWLNHIQNILVGASWIAAQIAQESASV
LIHCSDGWDRTTQLIALACLLLDPYYRTFNGFQALVEKDWLAFGHPFAERMGIPTVTENG
GSQYELLRQPSLGNLSSSPSRSTLGTPGSSSNTSVQSQTSNNSSPILLQWLDCIAQLLRL
YPSAFEFSSKFLVDFMDCVFSCRFGNFLCNSEREREQSGVTSSCHCMWTYLADLRASGGN
FHEHFNPFYDPVKYNAPLVPPAAALAPTLWPQFYLRWTCPPESQGGGLESQWHSMSKKYA
DSIKAKEIAESRSRDIKMKMESMLADLQRERRASSSALAMAQRARRENGAIKRAIRTIGC
NVNFSMNKNQVDKTEGLSYSVRREADSGAQEDDNADLSVSISAVEDSLVSETPSNQVCES
LCPFRTREGCRWPHAACAQLGSQFVGLKANFDAFDRLSIEDCYFGPE
Download sequence
Identical sequences I1I9E0
15368.BRADI3G42680.1 XP_010235401.1.954 EG:BRADI3G42680.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]