SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G42877.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G42877.1
Domain Number 1 Region: 94-175
Classification Level Classification E-value
Superfamily BEACH domain 1.14e-31
Family BEACH domain 0.00012
Further Details:      
 
Domain Number 2 Region: 73-103
Classification Level Classification E-value
Superfamily PH domain-like 0.00000738
Family PreBEACH PH-like domain 0.023
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G42877.1
Domain Number - Region: 31-86
Classification Level Classification E-value
Superfamily Radical SAM enzymes 0.00161
Family Biotin synthase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G42877.1   Gene: BRADI3G42877   Transcript: BRADI3G42877.1
Sequence length 180
Comment pep:novel chromosome:Brachy1.0:3:44264670:44267706:1 gene:BRADI3G42877 transcript:BRADI3G42877.1
Sequence
MLPPHEPFCRNSKSSKGLSSCLSVELKPEILVECLTSDFLGDLEGVASLANSGLDVYAHN
IETVRSLQRVVRDPRAGYLLRRSALELFMVDRSNFFFDFRRAKQILKRTQLMERWANWEI
SNFEYLMELNTLAGRSYNDITQYPVFPWIIPDYQSKVLNLDDPSTYRDLSKGRGSFLESR
Download sequence
Identical sequences I1I9H3
EG:BRADI3G42877.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]