SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G44330.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G44330.1
Domain Number 1 Region: 47-84
Classification Level Classification E-value
Superfamily WW domain 0.0000000423
Family WW domain 0.0053
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G44330.1
Domain Number - Region: 199-231
Classification Level Classification E-value
Superfamily NOB1 zinc finger-like 0.00915
Family NOB1 zinc finger-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G44330.1   Gene: BRADI3G44330   Transcript: BRADI3G44330.1
Sequence length 239
Comment pep:novel chromosome:Brachy1.0:3:46124047:46126461:1 gene:BRADI3G44330 transcript:BRADI3G44330.1
Sequence
MTSPNIEMIASSLRHCSLNGGGGRRSRARRRAERSDDSEGVTVELNSEVALPYHWQQCLD
IRTGQVYYINWEDGTRTTVDPRTSSSSSPFSSSPTPRSTPQASPRAASTSSSGASGYTSA
SSVGAGTAAAWFSGAGYGGYGYNDSDGYNDADEESSSSSSSSQSSAVSSFSPTDESASSG
SGSDNGNGNNAVHVLVAAGCRACFMYFMVPKSTGVCPKCGTPALLYLGRSGSNNNNAYA
Download sequence
Identical sequences I1IA05
15368.BRADI3G44330.1 XP_003572565.1.954 EG:BRADI3G44330.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]