SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G44717.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G44717.1
Domain Number 1 Region: 93-168,272-299
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000000157
Family alpha-D-mannose-specific plant lectins 0.0062
Further Details:      
 
Domain Number 2 Region: 380-416
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000628
Family Pan module (APPLE domain) 0.058
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G44717.1
Domain Number - Region: 275-346
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0667
Family Quinohemoprotein amine dehydrogenase B chain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G44717.1   Gene: BRADI3G44717   Transcript: BRADI3G44717.1
Sequence length 521
Comment pep:novel chromosome:Brachy1.0:3:46701719:46703284:1 gene:BRADI3G44717 transcript:BRADI3G44717.1
Sequence
MEAVTAPGKRIIMMCMAVAALLVSLGVRAGEAAPTAGAPAQELGRGFSAVHDTSYPQFQP
VLSDPTGVFALGFLRVNSSLLDIAVLHLPSAFPLWRAIPDRPAPWSAAASLSFNGSLVLT
DGATNQVLWSTPAAAAGDRAVLLNTSNLQIQSSSSPGAAWQSFDYPSDTIVQDQNLTSSA
ALYTVDRRFAMRLGSHYFGLYIEPPPSTSRGVAPAMYLKHTALEAKAQIEIGPNGAPIYA
RVEVDGFLGMYQKEGPPADVMSFDTFNHGIKAFRRMTLEPDGNLRAYYWDGSGSRWALDY
TAITDSCELPTTCGAYSVCVPPSGRCACLANATDGSGSCAAAETGSSGLCGTTGGEVGGL
YWTVRKQGVEPVNKELLGFEHAPSAEDCEARCARNCSCWGAVYSNGTGYCYLMDYPAQLM
VAADERRVGYFKVRSLEEEKASTGGRAAAGVKAALLAVGVALVVAAAAFGAYRVWDRRRR
TEAETMRQMGTDGDGLSPGPYKNLGSFSSVELSSSFNSFRR
Download sequence
Identical sequences I1IA55
EG:BRADI3G44717.1 XP_003575056.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]