SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G46270.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI3G46270.1
Domain Number - Region: 62-120
Classification Level Classification E-value
Superfamily TPR-like 0.0196
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 
Domain Number - Region: 268-334,404-475
Classification Level Classification E-value
Superfamily TPR-like 0.0228
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 
Domain Number - Region: 123-167
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 0.0712
Family CO dehydrogenase ISP C-domain like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G46270.1   Gene: BRADI3G46270   Transcript: BRADI3G46270.1
Sequence length 557
Comment pep:novel chromosome:Brachy1.0:3:48156395:48160478:1 gene:BRADI3G46270 transcript:BRADI3G46270.1
Sequence
MAAPPPAAAAPPPAMSALPTFASSHPYPSLPTTKPLTPNSRLNFAHAGVAASPNAVPHRA
VSNDRLRGLVRRGDLEEALRLVESMSGLEPSAAPGPCAALIKKLCASGRTAEARRVLAAC
EPDVMAYNAMVAGYCVTGQLDAARRLVADMPMEPDSYTYNTLIRGLCGRGRTGNALVVLD
DMLRRGCVPDVVTYTILLEATCKRSGYKQAMKLLDEMRAKGCAPDIITYNVVVNGICQEG
RVDDAIEFLKSLPSHGCEPNTVSYNIVLKGLCTAERWEDAEKLMAEMSQKGYPPNVVTFN
MLISFLCRRGLVEPAMEVLDQIPKYGCTPNSLSYNPILHAFCKQKKMDRAMAFVELMVSR
GCYPDIVSYNTLLTALCRGGEVDAAVELLHQLKDKGCTPVLISYNTVIDGLTKAGKTKEA
LELLNEMVTKGLQPDIITYSTISSGLCREDRIEEAIRAFCKVQDMGIRPNTVLYNAILLG
LCKRRETHNAIDLFIYMISNGCMPNESTYTILIEGLTYEGLVKEARELLGELCSRGVVSK
GLINKAAIRLLDGTTHT
Download sequence
Identical sequences I1IAP8
15368.BRADI3G46270.1 EG:BRADI3G46270.1 XP_010235566.1.954 XP_010235568.1.954 XP_014755384.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]