SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G46960.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G46960.2
Domain Number 1 Region: 8-241
Classification Level Classification E-value
Superfamily 14-3-3 protein 8.11e-105
Family 14-3-3 protein 0.00000000447
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G46960.2   Gene: BRADI3G46960   Transcript: BRADI3G46960.2
Sequence length 261
Comment pep:novel chromosome:Brachy1.0:3:48692527:48694080:1 gene:BRADI3G46960 transcript:BRADI3G46960.2
Sequence
MAQTVELSREENVYMAKLAEQAERYEEMVKFMEKVAKTVDSEELTVEERNLLSVAYKNVI
GARRASWRIISSIEQKEESHGNDDRVTLIKDYRGKIETELTKICDGILKLLDSHLVPSST
APESKVFYLKMKGDYYRYVAEFKSGAERKDAAENTMVAYKAAQDIALAELAPTHPIRLGL
ALNFSVFYYEILNSPDHACNLAKQAFDEAISELDTPSEESYKDSTLIMQLLRDNLTLWIS
DISDAAEHIKEAPKGESGDGQ
Download sequence
Identical sequences I1IAX5
EG:BRADI3G46960.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]