SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G47380.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G47380.1
Domain Number 1 Region: 28-339
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-56
Family Protein kinases, catalytic subunit 0.00048
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G47380.1
Domain Number - Region: 483-536
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00288
Family Myosin rod fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G47380.1   Gene: BRADI3G47380   Transcript: BRADI3G47380.1
Sequence length 672
Comment pep:novel chromosome:Brachy1.0:3:49017428:49023424:-1 gene:BRADI3G47380 transcript:BRADI3G47380.1
Sequence
MRRFNPFGGKVQNGLEGRTIDIGNVKITVRNAIAQGGFSCVYLACDTLHSSKQYALKHII
CNDLESLDLVMKEIQVMNVLKGHANVVTLVAHDVFDMGRTKEALLVMEFCEKSLVSAMES
RGTGYYEEKKALLIFRDVCNAVFAMHAQSPPIAHRDLKAENVLLGLDGAWKLCDFGSTST
NHKCFDKPEDRGIEEDIIRKHTTPAYRAPEMWDLYRREVISEKVDIWALGCLLYRICYFK
SAFDGESKLQVLNGNYRIPEQPKYSTAVTGLIKDMLEASPNARPDITQVWFRVNELLPLE
LQKSLPDGGSSAISMSLQDEGAHRRNHVMPRRNPPPPPREQSDSSVSYGSSNAGDAPLGA
FWGTQHAQGSQVTDDRNPLFDEEPIKPPPSSKYNQSRMDISTSTPGDKHGHSGQASRSTR
NFVSNNGLMGSSGTNLFMESQSSVKNKVSQPESKPKSGKDPFNSFVADFDANNLHLGTTA
TGKTSELEAEVSSLKEQLKKTTLEKAEMTAKYEKLSAICRSQRQEIQELKRTVAETTPPP
SIKVSSRIPESGSQRKEKIEGTVWELEQGMLAGKSSLPSSEAKTWQAFPEAKVQARPKVD
HATNGRQNLTRNTNAGPSPDAWGFGPDSFGMPSGSTAAAAQINRTSAQGSSSQRFSTGAA
KKVDQPSGWAGF
Download sequence
Identical sequences I1IB30
EG:BRADI3G47380.1 EG:BRADI3G47380.4 XP_003575255.1.954 XP_010235617.1.954 XP_014756099.1.954 15368.BRADI3G47380.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]