SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G47390.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G47390.1
Domain Number 1 Region: 482-776
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-73
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 58-205
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.58e-24
Family alpha-D-mannose-specific plant lectins 0.0049
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G47390.1
Domain Number - Region: 166-259
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000272
Family alpha-D-mannose-specific plant lectins 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G47390.1   Gene: BRADI3G47390   Transcript: BRADI3G47390.1
Sequence length 796
Comment pep:novel chromosome:Brachy1.0:3:49027328:49029718:1 gene:BRADI3G47390 transcript:BRADI3G47390.1
Sequence
MALLLLLLFLQAPFYAQAQKNITLGSILTIQGPNTSWVSPSGEFAFGFRPLDTNTSVYFL
AIWFNNIATKTVAWCAKTDKPVSVPSGSQLQLTHGGVLSLQDPAGMEIWNPRVTNINHAS
MLDTGNFVLYGKDGSIKWESFASPTDTILPSQVLVKGTVLRSRLMENDYSDGRFVLSVQV
DGNLRFYTVAVLASSLYDPPYWDSKTGGNGSSLVFNTSGGIYYTSNSGEQLKITSATLDS
PADFYHRATLDTDGVFRQYVYPRKAAQSNGWNMQWRIIDLLPRDFCKVVAGEIGSGACGF
NSYCSFNINKSVDCQCPPSYSFIDNERRYKGCKQDFAPHSCDLDEAESIQQFHLVPMNNI
NWPFSDYERYNPIGEDSCQKLCLTDCFCVAAVHYGSTCWKKRSPLSNGISGDIVGSVFLK
VPRTENPGSQFSSDSSTWKKERRYWILGSSLVLGGSVLVIIFLISLLCFGSYCTISRKKT
AQPQSMSYEALPLREFTYKEIEKATDGFREELGSGASGIVYKGQLQDEFRTSIAVKRIDK
MLPETEKEFAIEVQTIGRTFHRNLVRLLGFCGEGRERLLVYELMTNGSLNGFLFCGTRPT
WNLRVQVALGVARGLLYLHEECNTQIIHCDIKPQNILLDENLVAKISDFGLAKLLRTNQT
QTNTGIRGTRGYVAPEWFKNIGITSKVDIYSFGVILLETVCCRRNVELETDDEEQAILTY
WANDCYRSGRLDLLVEGDDEAIFNMKKVERFVAVALWCLQEEPTMRPTMLKVTQMLDGSV
TIPTPPDPSSFISSLQ
Download sequence
Identical sequences I1IB31
15368.BRADI3G47390.1 XP_003572669.1.954 EG:BRADI3G47390.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]