SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G47990.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G47990.1
Domain Number 1 Region: 323-627
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.59e-98
Family Protein kinases, catalytic subunit 0.000000315
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G47990.1
Domain Number - Region: 139-169
Classification Level Classification E-value
Superfamily Mediator hinge subcomplex-like 0.0915
Family CSE2-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G47990.1   Gene: BRADI3G47990   Transcript: BRADI3G47990.1
Sequence length 674
Comment pep:novel chromosome:Brachy1.0:3:49549085:49554312:1 gene:BRADI3G47990 transcript:BRADI3G47990.1
Sequence
MAAGRHGGYRGYEVARERELDLEAARRGKEYHHRHRHPSRHSDSDDRRDGGRSRDRELSN
GYSRRHSPHLPPKSRPSGRREEREPGEVSSRSGSEESFGRPLKPRETSVNGVPVARREGG
AMSPSKKRKHSPVILDRNGSKPRVQDIVKSTKEVDTLVAELPDVSTTASMDLDVSVDIQH
DERLQEHGNNRIMEEEEEDGYPITRNIMTSRWADADGEEEIVPKKKKSVSPQQGSTKKVA
SPELGELVVGSSGGDSVSSDSGVVRGSANGDLEVDKGDCIVEKDAGDDSSVVHMLDIDSE
SHACRSRILEPARSSRRCINMLQGCRSVDEFERLNTINEGTYGIVSRAKDLKTGETVALK
KVKMEKEREGFPLTSLREINILLSFHHPSIVDVQEIVVGSGDSTYMVMEYMEHDLKAVME
TMKQPYSQSEVKCLMLQLLEGVKYLHDNWVIHRDLKTSNILLNNRGELKICDFGLSRQYG
SPLKPYTQLVVTLWYRAPELLLGAKEYSTAIDMWSLGCIMAELLTKKPLFNGKRDIDQLS
KIIQMLGTPNESIWPGYSKLPGARAKFPKQPYNKLREKFPAVSFTGGLTLSEAGFDLLNR
MLTYDPETRISADAALNHEWFREVPLPQSRDFMPTFPSLNEQDRRMKKCMRSPDPLEEQR
MKEQGSIGDRGIFG
Download sequence
Identical sequences I1IBB0
15368.BRADI3G47990.2 XP_014756329.1.954 XP_014756330.1.954 XP_014756331.1.954 XP_014756332.1.954 XP_014756333.1.954 XP_014756335.1.954 EG:BRADI3G47990.1 EG:BRADI3G47990.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]