SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G48530.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G48530.1
Domain Number 1 Region: 231-429
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.00000912
Family NRPS condensation domain (amide synthase) 0.012
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G48530.1
Domain Number - Region: 42-178
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.000756
Family CAT-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G48530.1   Gene: BRADI3G48530   Transcript: BRADI3G48530.1
Sequence length 442
Comment pep:novel chromosome:Brachy1.0:3:49942241:49946543:1 gene:BRADI3G48530 transcript:BRADI3G48530.1
Sequence
MKITVRGSTVVRPAEETPRMRLWNANPDLVVPRFHTPSVYFYRRDAAVEVGCYFDAERMR
RALAEALVPFYPMAGRLARDEDGRVEIDCNAEGVLFVEADAPDGTVDDYGDFAPTMELKR
LIPAIDFTGGISSYPLLVVQVTHFKCGGVALGIGMQHHVADGFSGLHFINSWADLCRGVP
IAVMPFIDRTLLRAHDPPTPAHPHIEYQPAPAMLDSEPPQAILAGAKPDQPPAAVDIFKL
SRSDLGRLRAQLPTGEGAPRFSTYAVLGAHVWRCASLARGLAPEQPTKLYCATDGRQRLL
PPLPEGYFGNVIFTATPLAEAGKVIASLADGANTIQAALERMDNEYCRSALDYLELQPDL
SALVRGAHTFRCPNLGLTSWVRLPIHEADFGWGRPVFMGPGGIAYEGLAFVLPSASRDGS
LSVAISLQAEHMEKFRKMIFDF
Download sequence
Identical sequences I1IBH8
EG:BRADI3G48530.1 15368.BRADI3G48530.1 XP_003575337.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]