SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G49070.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G49070.1
Domain Number 1 Region: 27-273
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.23e-66
Family Succinyl-CoA synthetase, beta-chain, N-terminal domain 0.0000039
Further Details:      
 
Domain Number 2 Region: 274-419
Classification Level Classification E-value
Superfamily Succinyl-CoA synthetase domains 1.31e-54
Family Succinyl-CoA synthetase domains 0.0000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G49070.1   Gene: BRADI3G49070   Transcript: BRADI3G49070.1
Sequence length 422
Comment pep:novel chromosome:Brachy1.0:3:50461291:50466991:1 gene:BRADI3G49070 transcript:BRADI3G49070.1
Sequence
MVRGSLGKLASRALSVAGKWQHQQLRRLNIHEYQGAELMGKYGINVPKGAVVGSVQEVKE
VLNKVFPSEKEIVVKSQILAGGRGLGTFKSGLQGGVHIVKAEEAEGLAAKMLNQILVTKQ
TGPQGKVVGKVYLCEKMSLVNEMYFAITLDRKTAGPLIIACSKGGTSIEDLAEKYPDMII
KVPIDVFKGITDEDAGKVVDGLAPKTADRQASIEQIKKLYELFCKSDCTMLEINPLAETA
DKKLVAADAKLNFDDNAAFRQKEIFALRDTTQEDPREVAAAKADLNYIGLDGEIGCMVNG
AGLAMATMDIIKLHGGTPANFLDVGGSASEGQVVEAFKILTSDDRVKAILVNIFGGIMKC
DVIASGIVNAAKQVDLKVPVVVRLEGTNVDQGKRILKESGMALITAEDLDDAAEKAVKAY
IK
Download sequence
Identical sequences I1IBP6
15368.BRADI3G49070.1 EG:BRADI3G49070.1 XP_003575382.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]