SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G50220.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G50220.1
Domain Number 1 Region: 20-90
Classification Level Classification E-value
Superfamily Homeodomain-like 1.34e-17
Family Homeodomain 0.0044
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G50220.1
Domain Number - Region: 87-136
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00217
Family Myosin rod fragments 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G50220.1   Gene: BRADI3G50220   Transcript: BRADI3G50220.1
Sequence length 225
Comment pep:novel chromosome:Brachy1.0:3:51444723:51445863:1 gene:BRADI3G50220 transcript:BRADI3G50220.1
Sequence
MESDCQFLLAPPMYGDGQFLQQQLMGGSGEIRKRRFTDEQVRSLESTFHSRRAKLEPREK
AELARELGLQPRQVAIWFQNKRARWRSKQLEHDFADLRAHYDDLHARVESLKQEKLTLAA
QLEELKEKLSERQDQSGSSDDGAEHEVDHDKDVRDNKVSCVVEEEEAEGAAPVVDVVSDE
SAVGWYEYERLAYGGGAAAALPEPFCATPELWETTWPLVEWNAVA
Download sequence
Identical sequences I1IC31
XP_003569986.1.954 EG:BRADI3G50220.1 15368.BRADI3G50220.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]