SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G50240.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G50240.1
Domain Number 1 Region: 332-576
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.24e-65
Family Extended AAA-ATPase domain 0.000000165
Further Details:      
 
Domain Number 2 Region: 590-785
Classification Level Classification E-value
Superfamily FtsH protease domain-like 1.44e-41
Family FtsH protease domain-like 0.0000467
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G50240.1   Gene: BRADI3G50240   Transcript: BRADI3G50240.1
Sequence length 811
Comment pep:novel chromosome:Brachy1.0:3:51462949:51469001:1 gene:BRADI3G50240 transcript:BRADI3G50240.1
Sequence
MASAAAETLVSLPIASPSRSLLRPLRRRAASRGGAASIRLSAVPPRGLGLALIHRRIHYP
PAARANVERDGDGASGPGEASSTGDGDRDAAAETGGDSTSASTTSAAATPPSPPSSSKRG
ENKWRRRVLKGGGGVGRWFWEPIVQGREMGFLLLQLGFAIFALRMLRPEITLPGSEPRPQ
TTYISVPYSDFLASIDKDQVKKVEVDGVHVMFRLRPEVEASVVEQPQTQRVTDAVADNAV
VSRRIVFTTTRPVDIKTPYEKMVENSVEFGSPDRRSGGMLNSALVALIYVVLIAVVLQRL
PISFSQQSTGQLRNRKNSNSGGAKVSESADIVTFADVAGVDEAKEELEEIVEFLRNPERY
VRLGARPPRGVLLVGLPGTGKTLLAKAVAGEAEVPFISCSASEFVELYVGMGAARVRELF
ARAKKESPSIIFIDEIDAVAKSRDGRYRIVSNDEREQTLNQLLTEMDGFDTNSAVIVLGA
TNRADVLDPALRRPGRFDRVVMVEAPDKFGRESILKVHVNRKELPLGKDVDLSGIAAMTT
GFTGADLANLVNEAALLAGRSNKEIVEKIDFISAVERSIAGIEKKHVKLKGNEKAVVARH
EVGHAVVGTAVANLLPGQPRVEKLSILPRSGGALGFTYTPPTTEDRYLLFVDELRGRLVT
LLGGRAAEEIVLAGRVSTGALDDIRRATDMAYKAVAEYGLNQRIGPISLATLSNGGLDDS
GGSPFGRDQGRLVDLVQGEVKALLQSALEVALSVVRANPAVLEGLGAYLEENEKVEGEEL
QEWLKSVVAPKELTSFITGKQELVLQLEVGP
Download sequence
Identical sequences I1IC33
EG:BRADI3G50240.1 XP_003569989.1.954 15368.BRADI3G50240.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]