SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G50680.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI3G50680.1
Domain Number - Region: 263-388
Classification Level Classification E-value
Superfamily PH domain-like 0.000333
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G50680.1   Gene: BRADI3G50680   Transcript: BRADI3G50680.1
Sequence length 399
Comment pep:novel chromosome:Brachy1.0:3:51816883:51818264:-1 gene:BRADI3G50680 transcript:BRADI3G50680.1
Sequence
MEGYLLGKIKRKDHLLLMEGAGAPASAAVQSPQTPVEPMEFLSRSWSVSASDISKVLAVG
GGGRRSSNNYVVDRLSGILMPETLALAAASGTNPSPHNHKRTCRSRSAIAAHHHTIGRWF
HHRDGSSRVDKARAERARVHAAVSVASVAAAVAAVAANSEDNDMETMEDAKMDAALASAT
QLLASHCIEFAELAGADHDQVASAVEAAVDVRSPGDLMTLTAAAATALRGATALRLREQR
EAKSKAAVAPFDKSSSCGGRAADIWCKEGTLLKRSRKGALHWKRVAVYVNKRSQVIVKLK
SKHIGGAFSKKKRSVVYGVYDDVPAAHESAGGLPDSGTAATEEKRHFGLRTAQGLVVFEC
ESGMQKQDWLESVKNLLRQVAGGASQLERSFESLRLSAS
Download sequence
Identical sequences I1IC90
EG:BRADI3G50680.1 XP_003570027.1.954 15368.BRADI3G50680.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]