SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G51397.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G51397.1
Domain Number 1 Region: 536-818
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-68
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 845-923
Classification Level Classification E-value
Superfamily RING/U-box 3.36e-23
Family U-box 0.0013
Further Details:      
 
Domain Number 3 Region: 60-178
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0000000268
Family Universal stress protein-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G51397.1   Gene: BRADI3G51397   Transcript: BRADI3G51397.1
Sequence length 931
Comment pep:novel chromosome:Brachy1.0:3:52453681:52458973:-1 gene:BRADI3G51397 transcript:BRADI3G51397.1
Sequence
MEETGAGGAVYRRWDTSGSGSRYSFRTSVSSLAEMDGEVVEEETLVNQQAEAAGAEDDRV
FVAVPQEVKHGKSALLWALQNLAKDGARVVLAHVHCPSQMIPMMGAKIHYTRMNPEQVKD
HREKERQKASEKLDEYVVMCTTLKVSCEKIMIDKDDVAKGLEELIALHGITKLVMGAASD
KNYSKKLKTPKSKTSLRLMEAGAPSCKIWFTCKGILICTREANTTVPAVPPSPAPTVAST
LSENSISSHMRSLTIHHTESEASSSNGSPKQGLNRSVTAVPRHTSRAAGSTPSRLFEPFK
LNANSRPPRTPMSSLDSWDDFGRRSESSWYNLSRNGDATSVSESAMQHPLNESDDDRLSS
PSHELESSGVDAEMYARLEEALRESQESKKEAFEESTKRRKADHELFSALHKIVKRVIQT
NEDKLLLQAKELEKLYHHEIRQRKTIEETLLRQTQEIQEMTILRDTIYNDLHDAEEQKII
LEQCVTKTKSTLESHEEKLATSKYLIEVLQADKVKLQQERDAAVTAAEELRQKNEQRISM
PTEALNTEFSAFELEQATRCFDEALKIGKGGFGCVYKGSLRNTTVAIKLLHPESLQGQSE
FNQEVAVLGRVRHPNLVALIGSCRETFGLVYEFLPNGSLEHRLACTNNTRPLTWQVRTRI
IYEMCSALSFLHSNKPHPVVHGDLKPANILLDANLVSKLGDFGICRFLTQSNASATTTLH
RTTTPRGTFAYMDPELLSTGEITPRSDVYSFGIIILQLLTGRPPQKIAEVVEDAVVNRDL
HSILDPSAGSWPFVQANQLAHLGLRCAEMSRRRRPDLARDVWMVVEPLMKAASLTAGRPT
FAAASRGEASTPSYFVCPIFQELMNDPHIAADGFTYEAEAIRGWLDSGHDTSPMTNLKLA
HRELTPNRGLRSVILEWQQQQRQQELDEDWR
Download sequence
Identical sequences I1ICH9
EG:BRADI3G51397.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]