SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G51950.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G51950.1
Domain Number 1 Region: 230-612
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.09e-89
Family Regulator of chromosome condensation RCC1 0.00033
Further Details:      
 
Domain Number 2 Region: 614-682
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000163
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0018
Further Details:      
 
Domain Number 3 Region: 15-94
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000357
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G51950.1   Gene: BRADI3G51950   Transcript: BRADI3G51950.1
Sequence length 1005
Comment pep:novel chromosome:Brachy1.0:3:52921212:52927069:1 gene:BRADI3G51950 transcript:BRADI3G51950.1
Sequence
MAGGLEGRSSATRGVEQAIVALKKGAHLLKCGKRGKPKFCPFKLSSDEKMLIWYSKEREK
HLSLSYVSSVVLGQKTICKDREQVECWYLGLTALLSALYSPLLLVDSTSSRRINSCTSSP
PSYIQQKSRLFSVHDTRKFTQVHSLYGSPRLIQNKLSKSNLDCSEPFVSPRQRTWSDLDF
YMEKFTPEMINRVKNSFQDLTVADTIKEQGITQMPKLKPSEGSHVAYGTDSLKDIFVWGD
VLGSVLDDRDTSKANVSLPRLLNSTQILDVQNVSCGEKHAAIVTKQGEVFSWGKEDGGRL
GHKVSVGVLHPKIIESLAFTHVKAIAFGAKHTCALAISGELFEWGEGTHSLGVWDDQCQR
SQWYPHKLFGPLEGVSVVKMACGQWHTAIISSSGQLFTYGDGTFGVLGHGDTSSVARPKE
VESLKGLRVKAVACGPWHTAAIVEILGTVKSNAPSGKLFTWGDADRGKLGHSDKESKLVP
TCVKALTDSDFAQVSCAKALTVALTITGVVFTIGSKEHGQLGSHRLDDSSICSVEGPLKT
EFVREISSGSSHVAVLTMNGKVFTWGKGTEGQLGLGNYVDRSSPTLVEALEDKQVDSIAC
GSNFTVAVCLHRSISGKDQSVCSRCRLSFSFARKKHNCYNCGSMFCNSCSNNKVSRAALG
PDRNKRYRVCDACFTQLQKNEECGTVSSRLTIEKEEAFPTEIRAYTPKLSRIFKEANSIM
EKMALAQGYHQRNQDLAAPDQLRIQRWGQVECPSQFRCARNSIPCCSTSKEQTVDESVPA
KSAQSASSLKAELDSTEKILLEEVKQLQAHVTTLTEQCRYRSLKVQLCKQKVEETWLIVR
DEAAKCKAAKEIIKVLTNQRNILSRKILVGKHSYSSETVPSHMTIGQPVKAELPDPPDKH
PVIGKFRRLSSIRDHHRNGRGTYNASNIYAEEADATIPPIDSNGVVEQIERGVYVTIVTS
PSGNKGIKRIRFSRKHFGEKEAQKWWEANESRVFKKYSSMEKMTE
Download sequence
Identical sequences I1ICP7
EG:BRADI3G51950.1 15368.BRADI3G51950.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]