SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G52200.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI3G52200.2
Domain Number - Region: 47-168
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 0.00235
Family UDP-N-acetylglucosamine 2-epimerase 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G52200.2   Gene: BRADI3G52200   Transcript: BRADI3G52200.2
Sequence length 225
Comment pep:novel chromosome:Brachy1.0:3:53182585:53185677:-1 gene:BRADI3G52200 transcript:BRADI3G52200.2
Sequence
MGLDAFAAACCAIPVLASLLAVRFAYVLCRSGLPPTRPRAAGLRCLIVLGSGGHTAEMMN
IITELQKDRFTPRYYVAALTDSMSLQKAQVYEKSLIQGEGEKIIKNAQFMQIYRSREVGQ
SYITSIATTLLAVLHALWLIIRIRPQVIFCNGPGTCIPLCASAFLLKVLGLGWSSIFYIE
SIARVKKLSLSGLLLYKLRISDQFFVQWTQLQQKYPRAQYAGRLM
Download sequence
Identical sequences I1ICT2
EG:BRADI3G52200.2 XP_003570142.1.954 15368.BRADI3G52200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]