SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G53070.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G53070.1
Domain Number 1 Region: 74-365
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-82
Family Protein kinases, catalytic subunit 0.0000927
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G53070.1   Gene: BRADI3G53070   Transcript: BRADI3G53070.1
Sequence length 421
Comment pep:novel chromosome:Brachy1.0:3:53848137:53850574:1 gene:BRADI3G53070 transcript:BRADI3G53070.1
Sequence
MVGSAYRLRHRRLMDTAPATASSDPGHSSSNGMPIMVSILVVVIICTLFYCVYCWRWRKR
NAVRRAQIQNMRPMSSSDLPLMDLSSINAATNSFSKENKLGEGGFGPVYRGVLDGGAEIA
VKRLSARSRQGAAEFRNEVELIAKLQHRNLVRLLGCCVEKDEKLLVYEYLPNKSLDAFLF
GTRKTAHLDWKMRQSIILGIARGLLYLHEDSSLKIVHRDLKASNVLLDNKMNPKISDFGM
AKIFEDEEIEVNTGHVVGTYGYMAPEYAMEGVFSVKSDVYSFGVLVLEILSGQRNGAMYL
QEHNHTLIQDAWKLWDEDKAAEFVDASLAASYAKDEAWRCYHAGLLCVQESPELRPTMSG
VVLMLISDQAQLPAPAQPPLFASPRTTKRATQASEFSLGTGTDTTKTQSVNDVSITMIEP
R
Download sequence
Identical sequences I1ID43
XP_003572866.2.954 EG:BRADI3G53070.1 15368.BRADI3G53070.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]