SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G54140.3 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G54140.3
Domain Number 1 Region: 26-295
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-36
Family Protein kinases, catalytic subunit 0.0034
Further Details:      
 
Domain Number 2 Region: 492-615,655-840
Classification Level Classification E-value
Superfamily ARM repeat 2.66e-32
Family HEAT repeat 0.019
Further Details:      
 
Domain Number 3 Region: 1032-1283,1313-1357
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.52e-28
Family WD40-repeat 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G54140.3   Gene: BRADI3G54140   Transcript: BRADI3G54140.3
Sequence length 1388
Comment pep:novel chromosome:Brachy1.0:3:54659440:54667832:-1 gene:BRADI3G54140 transcript:BRADI3G54140.3
Sequence
MGNKIARTTQASATEYYLHDLPSTYNLVLLDVVSRGRFLKSVLCKHDEGLLLVKVYFKRA
GEPLDLKEHERRLERIRNAFQGLEGSHVWPFQVWFQTDKAAYLLRQYFYSNLHDRLSTRP
FLSQIEKKWLAFQLIHAVEQSHSKGVCHGDIKCENVLVTSWNWLYLADFASFKPTYIPDN
DPSDFSFFFDTGGRRRCYLAPERFHEHGGESQVSADAPLQPSMDIFSVGCVLAELFLEGQ
PLFELSQLLAYRRGQYDPLHTLEKIQDADIQDMVLHMIQLDPKERLSCKSYLQKYETVVF
PTYFSRFLHKFFSDIVPLDSDARVEKTQENFERIHDMMISGSTSEHIQVSEKKGIGGQVI
NSPRESSKGTSSVKKNIPRDHRQIVGDLNSLLKEVEQRNNHADSKAMKYTDSYAASNVSR
ANGIEPSPQVNETRIQTARVLAGQNNDVSHVHKISKSNLPALVSTYDVQSDTYSFDIFQQ
IHTKVSCEGMVLLASLLCSCIRSVKKPELRRASLILLKISSTYIDDDSRLQLVIPYVIAM
LSDPAAIVRCAALETLSDVLCLVQDFPISDAMIFPEYILPMLSLLPDDTEESVRVCYASN
IYKLALTAYRFLLHSRSIADTGPLDKSMVAAVSQSAESPAKKQQDKIHRQLARLRRCIYD
IVQELVMGPKQTPNVRRALLQDIGYLCYFFGHRQSNDFLLPILPAFLNDHDEQLRAVYFG
QIVVVCYFIGPRSVEEYLLPYLEQALSDDMEAVVVNVLDCLTMMCGSGYLRKRIIVGLFG
KALPLLCHPIQWVKRSAVRLIAACSESLGPVDTYVYLSPHLRQFLHREPPSISEAALLAC
LKPPVSKSVLYQALEVAKDTGDVVLKGGGKKEQTVHGGRYPATAQSGSLAALEDAARLRS
SNLSSNVSLDIKDSISSDKSLYYGYAQHASAGNSSFYDGLSKGIPSYSVCTDKRGLGEIF
MPWESNRHPGLSTSVQGLQTRENHFSSKHISESMKSSSSVPGDSVSNPETAGTPSFIRSA
VVLETGWKPRGVLVAHLQEHRMSVNDIAVSDDNAFFVTASDDSSIKIWDTRKLEKDIAFR
SRLTYSLGSSRALCTTMLYGSSQVIVGDSDGTLHLFSVDCARGVGSITDRYSGLVNVNRK
DLKEGAILSVINCSSDSFSPTILFSTEHCDIHKWDTRTNSESWSFKSSPEEGYISALVVG
QCGNWFISGSSRGVLTLWDHRFLLPVNSWNYSTVSPIERLCLLIPPQNSISSAGRPLVFV
AAGCNEVSLWNAENGSCHQMFRTASTENEAGMPKTPLRPINKTVTKDVRRAGSYKYRIEE
LADPHPRLPGIRCLLPLPGGDLLTGGTDLKIRYWDQARLNITIIHSLLLQFSVITCSIIY
FHVMILKA
Download sequence
Identical sequences I1IDH2
EG:BRADI3G54140.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]