SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G54170.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G54170.1
Domain Number 1 Region: 3-50
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 7.59e-22
Family Ribosomal protein L39e 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G54170.1   Gene: BRADI3G54170   Transcript: BRADI3G54170.1
Sequence length 51
Comment pep:novel chromosome:Brachy1.0:3:54682793:54683467:1 gene:BRADI3G54170 transcript:BRADI3G54170.1
Sequence
MPSHKTFRIKQKLAKKMRQNRPIPYWIRMRTDNTIRYNAKRRHWRRTKLGF
Download sequence
Identical sequences I1H0E6
EG:BRADI1G47500.2 EG:BRADI3G54170.1 15368.BRADI3G54170.1 XP_003564203.1.954 XP_003573648.1.954 XP_010235922.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]