SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G55350.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G55350.1
Domain Number 1 Region: 33-787
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.86e-283
Family Motor proteins 0.000000000021
Further Details:      
 
Domain Number 2 Region: 787-884
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000478
Family Motor proteins 0.034
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G55350.1
Domain Number - Region: 858-941
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0471
Family Myosin rod fragments 0.0067
Further Details:      
 
Domain Number - Region: 9-32
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.0942
Family Myosin S1 fragment, N-terminal domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G55350.1   Gene: BRADI3G55350   Transcript: BRADI3G55350.1
Sequence length 1511
Comment pep:novel chromosome:Brachy1.0:3:55592577:55605635:1 gene:BRADI3G55350 transcript:BRADI3G55350.1
Sequence
MQATQASIAVGSQVWVEDPDVAWIDGEVIKVHGDTVMIKCSNEKTVTAKASDVHAKDPEE
SPCGVDDMTKLAYLHEPGVLQNLKSRYDMNEIYTYTGSILIAVNPFRRLPHLYDIQMMEQ
YKGADFGELSPHPFAVADVAYRLMLNEGISQSILVSGESGAGKTESTKMIMRYLAYMGGK
AASEGRTVEKQVLQSNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDQKGRISGAAVRTYLL
ERSRVCQISDSERNYHCFYMICAAPPEELERYKLGDASTFHYLNQSKCYKIEGLDESKEY
LETRKAMDIIGISSQEQEAIFRVVAAILHLGNVEFAEGDDVDSSKPKNEKSMFHLRTAAE
LFMCDEKALEDSLCKRVIVTRDENIVKTLDPEAAKGSRDALAKTVYSRLFDWLVNKINNS
IGQDPNSKCLIGVLDIYGFESFKINSFEQFCINLTNEKLQQHFNQHVFKMEQEEYTKEEI
DWSYIEFVDNQDILDLIDKKPGGIIALLDEACMLPRSTHETFAQKLYQTFKNHKRFTKPK
LSRSDFTICHYAGDVTYQTELFLEKNKDYVVAEHQALLGASGCSFVSSLFPLLSEDSSKS
SKFSSIGSRFKQQLQSLLETLSATEPHYIRCVKPNSLLKPAIFENQNVLQQLRCGGVMEA
IRISCAGYPTRRTFYEFIDRFGLLAPGVLSGSSDEIIAVRRLLEKVDLQGYQIGKTKVFL
RAGQMAELDARRNEVLGRSASLIQRKIRSFLAKKSFIALRRSAVQIQAVCRGEIARGVYQ
SLRREAASLKIQTSYRMHHARKAYTELYVSAVTIQSCLRGLAARKEIHFRRQTRAAIIIQ
SRCRQFMARLDYSRTKKAALTTQCIWRGKVARKELRKLKMAARETGALQAAKNKLEKQVE
ELTWRLQLEKRMRADLEEAKSQENAKLQATLQEVQQQYKETKDTLVKEREAAKKVADIAP
VIKEVPVVDTELMNKLRDENDKLKTLVSSLEKKIDDTEKKYDETNKLSEERLKKAMDAES
KIDDLNMAMLRLQEKISNMECDEKVQRQALLTTPVRSMSEHLSIPIAPKNLENGYHEVEE
PKEPQSAPPAIKDYGNGDPKLRKSSVEKQLENVDALIDCVAKNLGYCEGKPVAAFTIYKC
LLHWKSFEAEKTSVFDRLIQLIGSAIENEEDNDNLAYWLSNTSSLLFLLQRSLKAAGAPG
SVSRKKPPQPTSLFGRMAQGLRSASFANMHVEATDVVRQVEAKYPALLFKQQLTAYVEKI
YGIIRDNIKKELSSLISLCIQAPRTMKASMLRMSGRSSGQPQSNHWQKIIENLDVLLRIL
QDNHVPPVLAQKIFTQIFSYINVQLFNSLLLRRECCSFSNGEYVKAGLAELELWCAKATA
EYAASSWDEIRHIRQAVGFLVIFQKFRISYDEIVHDLCPILSVQQLYRICTQYWDDKYNT
QSVSSDVLSNMRVLMTEDSNNAESSSFLLDDNSSIPFSVEDITNTILEKDFSDVKPAEEL
LENPAFQFLQD
Download sequence
Identical sequences I1IDW7
XP_003572943.1.954 15368.BRADI3G55350.1 EG:BRADI3G55350.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]