SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G55670.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G55670.1
Domain Number 1 Region: 20-198
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.0000934
Family CAT-like 0.071
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G55670.1
Domain Number - Region: 261-417
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.000311
Family NRPS condensation domain (amide synthase) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G55670.1   Gene: BRADI3G55670   Transcript: BRADI3G55670.1
Sequence length 456
Comment pep:novel chromosome:Brachy1.0:3:55841753:55843555:-1 gene:BRADI3G55670 transcript:BRADI3G55670.1
Sequence
MATTRVLDRLAVSAAEHGGGALPLTFFDVPWVFTGPVERVFFYAYPHPVEHFKATLLPSL
VSSLSAALAAFYPLLGRVRPCPGGGGGFEFWSEAGDSVEFTVAESDDDFDELSGDAPRDV
GRLYSLVPRLPARNTEDGGFSLAAVQVTVFPGQGLAVGVSIHHVACDDSSYMHFMKTWAG
HCRAAAGGEEDAVPPPPFLDRAVVKDPDGLAARTLDEMRQLASSNGPPPPAPPPLPKLVI
ASFTLGRDSIDKLKQRVAGAANGAGAVHCSAFTVACAFAWACLARSSAPNGCSSDRAHLL
FSVECRRRLAPPIPHEYLGNCLRPCFVDVPTADLLLPSASPDGVASAAAAIGAAIRALDG
GVLAGAEGWFHRILSLVPRRPMSVGGSPRYGVYETDFGPGMGRPRKVELVSIVKTPGTVS
MSEAGDGLGGIEVGVVLPEPDMARFASCFSQGLDQL
Download sequence
Identical sequences I1IE13
15368.BRADI3G55670.1 XP_014756634.1.954 EG:BRADI3G55670.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]