SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G55987.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G55987.1
Domain Number 1 Region: 499-787
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-76
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 118-193,285-300
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.01e-25
Family alpha-D-mannose-specific plant lectins 0.0031
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G55987.1
Domain Number - Region: 386-422
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000471
Family Hairpin loop containing domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G55987.1   Gene: BRADI3G55987   Transcript: BRADI3G55987.1
Sequence length 823
Comment pep:novel chromosome:Brachy1.0:3:56026093:56029389:1 gene:BRADI3G55987 transcript:BRADI3G55987.1
Sequence
MIILCYRLCFHSIAMGPANLLFLLLATATQLSVAQLLIHRTAKPSTVWINTAHSYGYYLD
QVPVLTCYPQPQASSGFKPAITAGFLSLCVSDTCDVYLFAVFLVHVVDNSTRVADSPQVL
WSANRNRPVREKATLEFSSDGNLVLRDADGSHVWSSNSSGRSVDGMVITEIGNLVLFDRR
NATVWQSFDYPTDTMVPGQSLVEGMRLIASTSATNTTENQLYVTVLQDGLYAYVESTPPQ
LYFSYNSIISKVGNDPTKATFMNGSLSIVVRPDVNDSISLPAVKSTQYMRLDSDGHLRLY
EWSTAGSTAVYDVMVINVCDYPTVCGEYGICSEGQCTCPLENGSSSTSFKLVDVRNPNLG
CTPLIPISCREIQSHQLLTLTGVSYFDMNYKVVNATTEDDCKQACLKNCSCRAVIFRVGE
CVWLTKVFSLQSVQPGYSSAYLKVQLSPPISASTSNKKKILGATLGAIATTLALLLIAII
LYLQRRRKYKEKGEEFYFDQLPGTPKRFSFENLNECTKGYSKKLGEGGFGSVFEGKIGEE
RVAVKRLEGARQGKKEFLAEVETIGSIEHINLVKLIGFCAEKSERLLVYEYMSRGSLDRW
IYYRHNNAPLEWYTRYNIILDIAKGLCYLHEGCRRKIAHLDIKPQNILLDDNFNAKVADF
GLCKLINRDQSKIMTVMRGTPGYLAPEWLTSRITEKVDVYSFGVVVMEIVCGRKNIDDSQ
PEENVQLINLLREKAQNSQLIDLIDKHSDDMISHQEEVIEMMKLAIWCLQNDSIQRPSMS
TVIKVLEGVMSAETFEANSIMFVQDNPSTYSVPSQASILSGPR
Download sequence
Identical sequences I1IE63
EG:BRADI3G55987.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]