SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G56035.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G56035.1
Domain Number 1 Region: 460-677
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.98e-39
Family Protein kinases, catalytic subunit 0.001
Further Details:      
 
Domain Number 2 Region: 770-854
Classification Level Classification E-value
Superfamily RING/U-box 2.56e-19
Family U-box 0.0031
Further Details:      
 
Domain Number 3 Region: 25-147
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.000000041
Family Universal stress protein-like 0.067
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G56035.1
Domain Number - Region: 329-461
Classification Level Classification E-value
Superfamily Tropomyosin 0.00785
Family Tropomyosin 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G56035.1   Gene: BRADI3G56035   Transcript: BRADI3G56035.1
Sequence length 869
Comment pep:novel chromosome:Brachy1.0:3:56059170:56063159:-1 gene:BRADI3G56035 transcript:BRADI3G56035.1
Sequence
MEVGGGSHEEEEEEEVPAAVVYCAVGKDGGREWKANLRWVLANFPHRSRRRFSLVLAHVH
RPPHRVNMMGAWVPVSQLAEHEVAAYSKLEEDRASRALDDLLHICTSQRVRARKVIVSAD
DAARGLVRLADDHAVAELVMGAASDRAYTRKMCAPRSKKAVTVQRKANPACRIWFLCKGN
LICTREADEVGLNRAEPSTSSSSPSPRSSSAVSDCSRSKPSMPFGMHESASAGPTTLRRR
TSSRDADSDNATDHNGAEDDHLGHDASSSSAAAAADVVGAFFSTAPAASGLRDAEDQDSP
APSHHGSSDGAGEMDDDALYERLKEALVEARNLRHEAYEETRRRQKADRDLAHASRMAKE
AESSWQGEARRRKETEERLARERVAMEQDRRDLDGILEKIMEVDGRSAELELQIADSERA
MSQLDVRLSESYGVLDALRLECERREEPATAGEPSVPEVDVAEQSMSFWRLGLSELEEAT
GHFNESARIGGGGVYRGSLRGMSVAVRMVSPEVAVDEARFTRAVEAMSRARHPGLVTFLG
ACPEARAVVHELVPGGSLEDRLEGKEAPTLSWQARCGVAYRTCSALAYILSTGAVHGDVR
PANILLEDEGCSSSKLAGFGTRGLVAAKERRRPGGVDVAYVDPRCLATGEPTPRSDVHAL
GVVLLRLVTGKPAFEARKAARDAAAGSTPWHEAVGHAGAGGWPVERATEVALLGLKCCAG
DEDEDVAGGGATAEQLLEEARGVLEAATMAAPGRTWSSLSSASGAGSESGGGAPSYFLCP
ILKVVRHSSISDVISMEVMRDPQIAGDGFTYEAEAMREWLGSGHDTSPMTNLKLPTDELL
PNHALRAAIQEWRHTTTPGTSSASSDRFH
Download sequence
Identical sequences I1IE68
EG:BRADI3G56035.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]