SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G56930.3 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G56930.3
Domain Number 1 Region: 20-183
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.72e-46
Family G proteins 0.00000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G56930.3   Gene: BRADI3G56930   Transcript: BRADI3G56930.3
Sequence length 187
Comment pep:novel chromosome:Brachy1.0:3:56641556:56643697:1 gene:BRADI3G56930 transcript:BRADI3G56930.3
Sequence
MTNENSTHGSNIFCFSLFFKQEMELSLVGLQNAGKTSLVNSIATGGYSEDMIPTVGFNMR
KVTKGNVTIKLWDLGGQRRFRTMWERYCRGVSAILYVVDAADRDSVPIAKSELHDLLTKQ
SLAGIPLLILGNKIDKSEALSKQALVDQLGLESIKDREVCCYMISCKDTVNIDVVIDWLI
KHSKTAN
Download sequence
Identical sequences I1IEI0
EG:BRADI3G56930.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]