SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G57120.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI3G57120.1
Domain Number - Region: 43-77
Classification Level Classification E-value
Superfamily Thiamin phosphate synthase 0.034
Family Thiamin phosphate synthase 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G57120.1   Gene: BRADI3G57120   Transcript: BRADI3G57120.1
Sequence length 86
Comment pep:novel chromosome:Brachy1.0:3:56773807:56774654:-1 gene:BRADI3G57120 transcript:BRADI3G57120.1
Sequence
MAVARLGGGGGGRKRLLGAIRRLRMRWVAAAYRRAVRRLRAFYARALEDLLVGAAAISTL
RAEAAGADYCSFGAAFAPVVSVPGRR
Download sequence
Identical sequences I1IEK2
15368.BRADI3G57120.1 EG:BRADI3G57120.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]