SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G57900.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G57900.1
Domain Number 1 Region: 526-834
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-72
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 85-212
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.03e-17
Family alpha-D-mannose-specific plant lectins 0.0059
Further Details:      
 
Weak hits

Sequence:  EG:BRADI3G57900.1
Domain Number - Region: 376-412
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0053
Family Pan module (APPLE domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G57900.1   Gene: BRADI3G57900   Transcript: BRADI3G57900.1
Sequence length 906
Comment pep:novel chromosome:Brachy1.0:3:57532601:57535572:1 gene:BRADI3G57900 transcript:BRADI3G57900.1
Sequence
MGPSPMRPPFLLSLLLLLLLGDVAQAGTVATELIAPDFEASFLLFVDTVGVFLRSSNGAF
EAAVYNPAAQQDRYYLAVLHAPSKTCVWAANRAAPITDRTALVRLTSQGVSVEDANGTAI
WSTPPFGSAVAALRLADTGNLALLDAANATLWQSFDVPTDTLVSSQRLPVGGFLASAASA
SDLAEGDYRLNVTSGDAVLSWTMGSSLYWRMSNDASFVKDRDGAVAYMAVNGTGIFLLAK
DGTVIVQAAAMAPAGLRVVQLSVDGKLQIKNFASANSSSSPTDGGFVAPSRACDLPLSCG
PLGLCTPSGNASGCTCPQLFAAAHDSGCAPSDGSSTLLPAGAGASCGGSGNGDRGISYLS
LGNGVAYYANKFSLPATAGSNASSCQALCTANCSCLGYFYDHSSLSCYLARDQLGSFTNT
NSTNGAHSMSGYVKVQSSRPQGSSSSDSSSSSKTLIAILLPTIIAFVLIVIIGAIVVVSW
RKEKRREGRRSSRDVQLRRQRSPGSASAHLVQDLQDMDGDDDDDIVIPGLPTRFTHSEIE
DMTNSFRVKIGAGGFGAVYKGELPDGSLVAVKKIEGVGMQGKREFMTEIAVIGNIHHVNL
VRLRGFCTEGQRRLLVYEFMNRGSLERPLFRPTGPPLEWKERMDIAVGAARGLAYLHFGC
NQRIIHCDVKPENILLADGGQVKIADFGLAKFLSPEQSGLFTTMRGTRGYLAPEWLTNTA
ITDRTDVYGFGMVLLELVHGRKNRSEHVSDGMASGEDSSNGSSSRGAARSNNDYFPLAAL
EAHEAGRYAELADPRLEGKVVAKEVERMVKVALCCLHEDPGTRPSMAVVAGMLEGTMELG
EPRAQALGFLRLYGRGHAGPSDGNMKQVVGMGMGTSVGDRNRSETTQTTMSGWPSYMSSS
QLSAPR
Download sequence
Identical sequences I1IEU4
15368.BRADI3G57900.1 EG:BRADI3G57900.1 XP_003570561.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]