SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G58160.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI3G58160.1
Domain Number - Region: 84-144
Classification Level Classification E-value
Superfamily TPR-like 0.0284
Family Transcription factor MalT domain III 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G58160.1   Gene: BRADI3G58160   Transcript: BRADI3G58160.1
Sequence length 156
Comment pep:novel chromosome:Brachy1.0:3:57701978:57702569:1 gene:BRADI3G58160 transcript:BRADI3G58160.1
Sequence
MSGGSGGERRGWSPMDAIRSFPSTPESLMSQIDAAIASTEYARACALLDPASSRPQPPAT
GSSNGGEASAARASPSPDPAAAPCHDARVADEAYRAACAALGAGRPDAAVRSLRAALASC
PPEKAAAVAKVRSMLAIASAQLHRQQHQAQQLNSRR
Download sequence
Identical sequences I1IEX4
XP_010236086.1.954 EG:BRADI3G58160.1 15368.BRADI3G58160.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]