SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI3G59800.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI3G59800.1
Domain Number 1 Region: 48-322
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.56e-30
Family G proteins 0.0011
Further Details:      
 
Domain Number 2 Region: 582-702
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-17
Family Pleckstrin-homology domain (PH domain) 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI3G59800.1   Gene: BRADI3G59800   Transcript: BRADI3G59800.1
Sequence length 954
Comment pep:novel chromosome:Brachy1.0:3:58915079:58923801:1 gene:BRADI3G59800 transcript:BRADI3G59800.1
Sequence
MSSSAAMEAIDELVQLSESMRQAASLLADDDPSDDAAPRRPSTFLNAVALGNVGSGKSAV
LNSLIGHPVLPTGENGATRAPIVVDLQRDPGLSTKSIVIQIDSKSQQVSASALRHSLQDR
LGKAVSSGRSRTDEIYLKLRTSTAPPLKLIDLPGIDQRVIDDSTINEFAGHNDAILIVVI
PAMQAAEVASSRALRLAKDIDPDGTRTIGVLSKIDQAAADAKTVACVQAILSNKGPRAAT
EIEWVALIGQSVALASAQSGSVGSENSLETAWRAEAETLKSILTGAPQSKLGRIALVDTI
AKQIRNRMKVRLPSLLSGLQGKSQIVKDELARLGEQKVESTEGTRAVALELCREFEDKFL
AHVTSGEGSGWKIVASFEGKFPDRIKQLPLDRHFDLSNVKRVVLEADGYQPYLISPEKGL
KSLIKGVLEMAKEPSRLCVEEVHRVLLDIVNATANGTPGLGRYPPFKREVITIASNALDT
FKNDAKKMVVALVDMERAFVPPQHFIRLVQRRMERQRREDEVKTRSSKKAQDAEQSMMNK
GSSAQTGSEAGGSLKSSKDKSSQQDKDSKEGSNLQVAGPGGEITAGYLLKKSAKNNEWSK
RWFVLNEKSGKLGYTKKQEERHFRGVIVLEECNLEEIEEEELSKSSKDSKKANGSEKGPS
LVFKITNRVAYKTVLKAHSAVILKAENMADKIEWMKKIRGIIQSKGGSVKGPNAPEGGSM
RQSHSDGSLDTMARRPADPEEELRWMSQEVRGYVEAVLNSLAANVPKAIVLCQVEKAKED
MLNQLYSSISSQSNAKIEELLQEDHNAKRRREKAQKQSSLLSKLTRQLSIHDNRAAVASY
SSDNSGTVAHRALVMQVRTGGLPLIQQQTALLTDQVHTMSQDQEVLTVAVGAMRMGMQMV
LILAAAAHQIGCHRHHLGRDNKNGKYMSAVICQHHIFVAGSHSRLILVEENTWD
Download sequence
Identical sequences I1IFG8
15368.BRADI3G59800.1 EG:BRADI3G59800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]