SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G00206.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G00206.1
Domain Number 1 Region: 571-877
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-69
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 95-183
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000000131
Family alpha-D-mannose-specific plant lectins 0.0096
Further Details:      
 
Weak hits

Sequence:  EG:BRADI4G00206.1
Domain Number - Region: 402-431
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0051
Family Pan module (APPLE domain) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G00206.1   Gene: BRADI4G00206   Transcript: BRADI4G00206.1
Sequence length 929
Comment pep:novel chromosome:Brachy1.0:4:24823:27803:1 gene:BRADI4G00206 transcript:BRADI4G00206.1
Sequence
MALPPPLRLLLQLLVVFLGTGGPLTAARTVPVEFLYPPFNLTYMHYIDTNGVFLLSGPNG
TFSAAVYNAGSGGGSSFDSQSRFFFSVLHDKSRTPVWTATAGSTILQSITLSLTAKGMAL
SYPADPDPAWSTPPLAAPVASLRLRDTGELALLDAANATLWSSFDRPTDTLLQGQRLPVG
ATLTASASDQDLSPGPYRLLLTPNDALLQWAPASSSSAPANASSLVTYWALSSDAGAVQD
SNLKVESMAVNASGIYLLAGNGRDTVLRLLFTPPPSSSSAKVLLKVGSSGRLRVLSMAIS
PTAARASLPSVWEAPGNDCDLPLPCGSLGLCTAGTGSNSSCMCPEAFSTHTTGGCSPADG
STTLLPTDDCANGSSSSSYTGLGDGVGYFASKFAVPATAGGALPACRDLCSANCSCLGFH
YRNSSKSCFLMLNQIGSVFRVNADSFSSTAAAVFIKTVPAASRGHGRGSSRLSSITIVFG
VVLPTVAAVFIAFLLYVMAKHWLNKRGGSNGQKKKKKKKKKKTKHESSEGWRRSWFMLHV
MSSSRASSNVPSEKDTEEDSEEEDDDPDAVLIPGLPTRFTFDELEAATNGFKRQIGSGGF
GSVYRGSLPDGTTVAVKRMNNLGTQGRREFLTEIAVIGNVHHVNLVKLRGFCAEGPQRQL
LVYEFMSRGSLDQSLFVSSNSGLAWPERVGVCVGAARGLAYLHSGCHRKILHCDVKPENI
LLDGRGGVKIADFGLAKLMSPEQSGLFTTMRGTRGYLAPEWLMNAPITDKADVYSFGMVL
LEIVRGRKNSKLLDDTGTSSGASDDGGKEERSRGYFPAMALAVHEEEASPGYSELADPRL
EGKVDAGEVSRVVRVALCCLHEEASLRPGMTAVAAMLDGSMEVCAPRTDQLSYLRMYGRA
GTTAGAGAASSSTWSPPSCVSAQQLSAPR
Download sequence
Identical sequences I1IFY2
EG:BRADI4G00206.1 XP_003579074.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]