SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G00900.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G00900.1
Domain Number 1 Region: 674-991
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.6e-62
Family Protein kinases, catalytic subunit 0.00024
Further Details:      
 
Domain Number 2 Region: 49-427
Classification Level Classification E-value
Superfamily L domain-like 1.02e-53
Family Polygalacturonase inhibiting protein PGIP 0.014
Further Details:      
 
Domain Number 3 Region: 345-572
Classification Level Classification E-value
Superfamily RNI-like 6.2e-42
Family Cyclin A/CDK2-associated p19, Skp2 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G00900.1   Gene: BRADI4G00900   Transcript: BRADI4G00900.1
Sequence length 1022
Comment pep:novel chromosome:Brachy1.0:4:466575:469908:-1 gene:BRADI4G00900 transcript:BRADI4G00900.1
Sequence
MASAAHLFFLASVILHLHAASAATPSSELAALLKFKASLTVPSTSASFFASWDPAATSPC
NFTGVTCSSGAVTAISVADLNVSSSAAVPFASLCAALGSLTTLSLPSNSLSGSIAGVTAC
AKLTELTLAFNVFSGAVPDLSPLTSLRVLNLSQNAFSGAFPWRSLSSMPGLVVLAAGDNL
FLDETPTFPEQITKLASLTALYLSAANIAGEIPPSIGNLVNLTDLELADNHLTGPIPASM
AKLVNLKSLELYNNNLTGPFPPGFGKMTKLQYLDASANKLTGGLSEIRTLTKLVSLQLFF
NGFSDEVPAELGEEFKDLVNLSLYNNNLSGELPRNLGRWSEFDFIDVSTNQLSGPIPPDM
CRRGTMKKLLMLENRFSGEIPLSYGGCRTLTRFRVSSNELSGEVPAGIWALPEVEIVDLA
ENEFTGGIGDRIGEASSLTNLILAKNKFSGEIPWSIGDAMNLQKLDLSGNGFSGEIPGSI
GKMKNLDSVNVEGNEISGAIPGSIGGCFSLTAVNFAGNRIAGEIPPELGEMTRLNSLDLS
RNEMTGEIPASLAELKLSYLNLSENRLQGPVPAALAIAAYGESFVGNPGLCSAGNGNGFL
RRCSPRAGGRREASAAVVRTLITCLLGGMAVLLAVLGVAIFVRKRREAEAAAAMAASASG
TKLFGKKGSWSVKSFSRMRLTAFDEREIVAGVRDENLIGRGGSGNVYRVKLGTGAVVAVK
HITRTTMAGTTSAAAAPMLRPSPSASARRCREFEAEVGTLSSVRHVNVVKLLCSVTSSED
GGNGGDGARLLVYEHLPNGSLQERLPELRWPERYEVAVGAARGLEYLHHGNGDRPILHRD
VKSSNILLDADFKPRIADFGLAKILHDSAAAATAPEAYSSGSGVVAGTVGYMAPEYGYTR
KVTEKSDVYSFGVVLLELVTGQAAIVGGCEEDIVEWVSRRLREKAVVVDGKAVTEDWEKE
EAARVLRVAGMCTSRTPAMRPSMRNVVQMLEDAAIGREYYYSAGSATSDEKMTAAVEVKV
VR
Download sequence
Identical sequences I1IG61
15368.BRADI4G00900.1 XP_003579100.1.954 EG:BRADI4G00900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]