SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G01647.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G01647.1
Domain Number 1 Region: 407-699
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-72
Family Protein kinases, catalytic subunit 0.00027
Further Details:      
 
Domain Number 2 Region: 292-345
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000614
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  EG:BRADI4G01647.1
Domain Number - Region: 260-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0838
Family EGF-type module 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G01647.1   Gene: BRADI4G01647   Transcript: BRADI4G01647.1
Sequence length 749
Comment pep:novel chromosome:Brachy1.0:4:1074539:1077226:1 gene:BRADI4G01647 transcript:BRADI4G01647.1
Sequence
MKLIVFFLPMALAMPVDGIALLALPGCPDKCGDVPIPYPFGIGAQCAAVSLNSFFNLDCN
NTFQPPRPMVGGPAGVAIEVADISLERGELRVLVPVSYICFTSSATEEEIVWWFSLRDTP
FLPSPGRNRFTVIGCNTLGLVGGFRGGTSQYLAGCYTYCDGPNGASDDGAPCTGTGCCEA
SIPINLTDLRVVFPNKNSSVWEFNPCFYAMIAEVGWYSFQRRDLVGQLGFVSNRAKNGVP
LIVNWAVRNGSCPEPRNYACVSTNSYCESASNGPGYLCQCSLGYEGNAYLHSGCQDIDEC
VLREQDPKNEELYPCRHGVCLNTPGGYDCKCKGGTKSDGTNFGCRPLHTRDEQLAIGLSV
SAIVMISSACFLIMQLQKRRHKKDKEEYFKQNGGLKLYDEMRSKQVDTVRILAEKEIRRA
TDNYSEDRVLGCGGHGMVYKGTLDDQREVAIKKSKVINDNCRDEFVNEIIILSQINHRNI
VRLLGCCLDIDVPMLVYEFVSNGTLYEFLHGSADHILSPIPLDLRLKIATQSAEALAYLH
SSTSRTILHGDVKSANILLDDQRHAKVADFGASALKSIDESEFIMLVQGTLGYLDPESFI
SHLLTDKSDVYSFGVVLLELVTRKKALYVDNNSNEKRSLSHNFLLMFHQNKHKTMLDPEI
TDNDVDMAVVEELAILDVQCLSARGDDRPTMQEVAERLRVLRRHLVYAAGDEKTHCYFDN
NYGGSPSVVLPLDEMTEGSFETCKLVLAV
Download sequence
Identical sequences I1IGE8
EG:BRADI4G01647.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]