SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G01660.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G01660.1
Domain Number 1 Region: 336-441
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000000542
Family Protein kinases, catalytic subunit 0.0078
Further Details:      
 
Domain Number 2 Region: 143-245
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000115
Family Growth factor receptor domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G01660.1   Gene: BRADI4G01660   Transcript: BRADI4G01660.1
Sequence length 483
Comment pep:novel chromosome:Brachy1.0:4:1081878:1084112:-1 gene:BRADI4G01660 transcript:BRADI4G01660.1
Sequence
MDNYTGGFNLVNTPFIPLTTRNRSQSSAAIQWVLLVATHSNPDLYVAGCYSYCQGINSTS
KGAPCTGKDCCETTITPNLTDFAALLVINQSSVWTFNPCFYAMLAEVGWYSFRQQDLVGH
LGFINEREKRGVPLVGDWAIRNGSCPKDGAKAPMGYACVSSNSYCMDAINGPGYTCNCSE
GYEGNPYLPKGCQDIDECKLYNQNPKYRELYPCKNGECRNTPGGYVCKCGIGKRSDGKNS
GCQPVLSQIERVVIGLSVSVVVVMALTFMLAMKFQRRKHRKEKDEYFKQNGGLKLYDEMR
SRQVDTIRILTEKEAKKATDNYSDDRVLAHGGHGMPHLTDRSDVYSFGVVLLELITRKRA
IFIDNLNEKKSLLHTFIMMFHQKKLYDILDYDIIEDEVMVVLEKLAELAMLCLGPRGDER
PTMKEVAGRLQMLRRIQLQQVTTENPIRMHYPDGEPAMSIPSEELKYQSMDTAKLALDVD
IAR
Download sequence
Identical sequences I1IGE9
15368.BRADI4G01660.1 EG:BRADI4G01660.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]