SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G01680.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G01680.1
Domain Number 1 Region: 420-708
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.09e-73
Family Protein kinases, catalytic subunit 0.00029
Further Details:      
 
Domain Number 2 Region: 304-358
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000281
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  EG:BRADI4G01680.1
Domain Number - Region: 269-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00469
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G01680.1   Gene: BRADI4G01680   Transcript: BRADI4G01680.1
Sequence length 759
Comment pep:novel chromosome:Brachy1.0:4:1090130:1092815:-1 gene:BRADI4G01680 transcript:BRADI4G01680.1
Sequence
MLELASVLLILIIFPVMVMEITAATSGHDVSLPGCPDKCGNVSIPYPFGIGDGCAATNIS
RYFSVTCNNTFEPPRPVVGGPLMQGEVIDISLVSGEMRIYGPISYSCFTSNTTTPDNKSS
EFSLEGTPFVPSATRNRFTVIGCSTLGLIGGSIHGDANPYVTGCYSYCHGLNSTSDGAPC
TGMGCCETTIVPNIINFTTTLLNLSSVWKFNPCFYAMLTEVGWYSFRRQDLVPHLGFVDE
RAKRGVPVVHDWAIRNGSCLEEGEKTQKNYVCVSSNSYCVNARNGRGYLCNCSEGYEGNS
YLPKGCQDIDECELRKQDPKYEQLYPCNNGVCQNLPGGYRCNCMIGTRSDGTNYGCQTVL
RQAERVAIGLSISAVKVMALTCLLVMKLQRRKHIKEKDAYFKQNGGLKLYDEMRARQVDT
VLLLTEQEIRKATDNYSDHRVLGCGGHGMVYRGTLDDDKELAIKKSKVIDNDCREEFVNE
IIILSQINHRNIVRLLGCCLEVDVPMLVYEFIPNGTLFEFLHGNDHRSPIPLDLRLKIAT
QSAEALAYIYSSTSRTILHGDVKSLNILLDDEYNAKVADFGASALKSLDKDDFIMFIQGT
LGYLDPETFVSHHLTDKSDVYSFGVVLLELMTRKKAIYSDDFNGKKSLSHTFVSLFHENK
LSNMLDYEIIEDEVMVVLWKVADLVMHCLSPRRDERPTMKEVAERLQMLRRIQMQLVTKS
NSTRAHYDYGGSSTLAPSDQMKHHSMDTTKLVIDVHKAR
Download sequence
Identical sequences I1IGF1
15368.BRADI4G01680.1 XP_010237018.2.954 EG:BRADI4G01680.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]