SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G01700.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G01700.1
Domain Number 1 Region: 115-273,318-448
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.5e-72
Family Protein kinases, catalytic subunit 0.00000847
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G01700.1   Gene: BRADI4G01700   Transcript: BRADI4G01700.1
Sequence length 474
Comment pep:novel chromosome:Brachy1.0:4:1107710:1109243:-1 gene:BRADI4G01700 transcript:BRADI4G01700.1
Sequence
MVAASGLGKPPPQPAREEGMLGLSPPVVAVAAEESLSDAETASSSSTTAAGGAPNSSLSS
GSSSSSGRSLARCSSCLSRLSFSSSPSASLASPARPHRSSDPAWAAIRAASLKSPLGPAD
FKLVRRVGGGDIGTVYLCRLLLPHGGTSSSSPPCVYAMKVVDRRRLAGKKKPERERRILR
RLDHPFLPTLFADFDAAPHLSCAVTEFCPGGDLHSLLLRRRRLPLPSARFYAAEVLAALE
YLHMMGIVYRDLKPENVLIRADGHVMLTDFDLSLQSSSSPFVLDDDEDEQPATSCFPRRR
RKKREPRMVVAEPVAARSRSLVGTHEYVAPEVASGGTHGAAVDWWALGVLLYELLHGRTP
FAGADNEATLRNVVSAPLAFPPSGSLCGGAMDAAMADARDLIARLLAKDPAARLGARRGA
ADVKAHRFFRGVNFALLRSARPPLVPSVPGGGPVRRSQSCKAPPRPEPGRFDLF
Download sequence
Identical sequences I1IGF4
XP_010238859.1.954 EG:BRADI4G01700.1 15368.BRADI4G01700.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]